Recombinant G-protein coupled receptor ZK643.3 (ZK643.3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
seb-2; ZK643.3; G-protein coupled receptor seb-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-480
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
seb-2
Target Protein Sequence
MNPSISTAGAVVDDFQMSCRFSNFGDHAPESFDSLSCGACFYFIFMLVEHYKDRYVASLC EDTFGVLVCPVDVSDKICNCYNREYVYNIPEFALNSSRIKPLNHLRLDPPLPFQFDLIVK DCCSAARYCCRNTLVKYHHRVDDSPCPPTWDGWNCFDSATPGVVFKQCPNYIYGGSNIKT DYDRLSQKVCRSNGWATPEVNAAAREHTDYTGCMSNGDVEARILAGLLTYSASVIFLIPA VFLLTLLRPIRCQPMFILHRHLLISCLLYGAFYLITVSLFVVNDAPLSSQVFQNHLFCRL LFSIQLRYLRLTNFTWMLAEAVYLWRLLHTAQHSEGETLRSYKVICWGVPGVITVVYIFV RSLNDDVGMCWIENSTVAWIEWMIITPSLLAMGVNLLLLGLIVYILVKKLRCDPHLERIQ YRKAVRGALMLIPVFGVQQLLTIYRFRNVCLIYRLLHKSFCRRMCSEILVITSGEAGSRS
Uniprot No.

Target Background

Function

Function: Putative receptor. Further details are currently unavailable.

Database Links

STRING: 6239.ZK643.3b

UniGene: Cel.9532

Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Present in the head body-wall muscles from the L1 larval stage through to adulthood. Also expressed between L4 and the adult molt in vulval vm1 muscle cells. These cells play a role in opening the vulva during egg laying.

Q&A

What is ZK643.3 and why is it significant for research?

ZK643.3 is a G-protein coupled receptor that, like other GPCRs, plays extensive roles in cell signaling pathways. GPCRs represent significant drug targets due to their involvement in numerous physiological processes. Despite their importance, many GPCRs, including potentially ZK643.3, have limited or no available therapeutic interventions. Understanding ZK643.3's structure and function contributes to both basic cell signaling research and potential drug discovery efforts .

What expression systems are most suitable for recombinant ZK643.3 production?

Multiple expression systems can be considered for ZK643.3 expression, each with distinct advantages:

Expression SystemAdvantagesLimitationsSuccess Factors
E. coliGenetic tractability, rapid growth, cost-effectiveLow stability, tendency for aggregationFusion partners, selective mutagenesis, stabilizing mutations
P. pastorisPost-translational modifications, disulfide bond formation, glycosylationPotential hypermannysylation causing misfoldingN-glycosylation site engineering
Mammalian cells (e.g., HEK293)Native-like folding environment, appropriate post-translational modificationsHigher cost, lower yieldsCodon optimization, Kozak sequence addition, signal peptide fusion

The choice of expression system should be guided by research goals, downstream applications, and specific stability requirements of ZK643.3 .

How can I verify that my recombinant ZK643.3 is properly folded and functional?

Functional verification requires multiple complementary approaches:

  • Cell surface expression analysis: Using fluorescently-tagged constructs or antibodies against extracellular epitopes to confirm proper membrane localization.

  • Ligand binding assays: If ligands are known, conduct radioligand or fluorescent binding assays to determine affinity constants and binding capacity .

  • Signaling validation: Implement NanoBRET assays or traditional signaling readouts (cAMP, calcium flux) to verify functional coupling to downstream pathways .

  • Structural integrity assessment: For purified protein, circular dichroism spectroscopy can evaluate secondary structure content characteristic of properly folded GPCRs.

  • Thermal stability analysis: Techniques like differential scanning fluorimetry can assess protein stability and proper folding in different conditions.

What strategies optimize ZK643.3 expression in bacterial systems?

Successfully expressing ZK643.3 in E. coli requires specific adaptations:

How should I optimize ZK643.3 gene constructs for mammalian expression?

For optimal expression in mammalian systems:

  • Codon optimization: Adapt the ZK643.3 gene sequence specifically for mammalian expression to enhance translation efficiency .

  • Regulatory elements: Include a Kozak sequence (GCCACCATGG) at the 5' end to enhance translation initiation .

  • Signal peptide fusion: Adding signal peptide sequences to the 5' end improves cell surface delivery of the receptor .

  • Vector selection: Choose between transient expression vectors (for rapid screening) or stable integration vectors (for consistent long-term expression) .

  • Fusion tags consideration: Strategic placement of affinity, fluorescent, or epitope tags that minimally interfere with receptor function.

  • Functional validation: Develop robust binding or signaling assays to confirm that genetic modifications preserve receptor functionality .

What membrane solubilization and purification techniques work best for ZK643.3?

The purification strategy should be tailored to experimental requirements:

  • Membrane preparation: Initial isolation of cell membranes through differential centrifugation preserves receptor integrity before solubilization.

  • Solubilization approaches:

    • Detergent-based extraction: Detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are commonly effective for GPCRs.

    • Styrene maleic acid (SMA) co-polymer approach: This alternative extracts membrane proteins with surrounding lipids, forming SMA lipid particles (SMALPs) that maintain a more native-like environment .

  • Affinity chromatography: Strategic tagging of ZK643.3 enables efficient purification through affinity resins.

  • Size-exclusion chromatography: Critical for separating monomeric receptor from aggregates and verifying sample homogeneity.

  • Purity and functionality verification: Combining SDS-PAGE analysis with activity assays ensures both purity and native folding.

How should I design robust experiments to study ZK643.3 function?

Proper experimental design follows systematic principles:

  • Variable definition: Clearly identify independent variables (e.g., ZK643.3 expression levels, ligand concentrations), dependent variables (downstream signaling metrics), and control for extraneous factors .

  • Hypothesis formulation: Develop specific, testable hypotheses about ZK643.3 function based on structural understanding and GPCR signaling principles .

  • Treatment design: Methodically plan how to manipulate independent variables, including appropriate dose ranges and time points .

  • Subject assignment: Determine whether between-subjects or within-subjects design is more appropriate for your specific research question .

  • Measurement planning: Establish reliable methods to quantify dependent variables with appropriate sensitivity and dynamic range .

This systematic approach minimizes several types of research bias, including sampling bias, survivorship bias, and attrition bias that can compromise data interpretation .

What controls are essential when studying ZK643.3 signaling?

A comprehensive control strategy includes:

  • Negative controls:

    • Untransfected cells or cells expressing irrelevant GPCRs

    • Vehicle-only treatments matching solvent conditions

    • Expression of signaling-deficient ZK643.3 mutants

  • Positive controls:

    • Well-characterized GPCRs with known signaling properties

    • Constitutively active mutants or direct G-protein activators

    • Pathway-specific activators that bypass receptor activation

  • Expression controls:

    • Quantification of surface vs. total ZK643.3 expression

    • Monitoring expression levels across experimental conditions

    • Normalization strategies for variable expression levels

These controls help distinguish receptor-specific effects from non-specific or background signaling events.

How can I apply multiomic approaches to study ZK643.3 function?

Multiomic strategies provide comprehensive insights into ZK643.3 biology:

  • Transcriptomic analysis: RNA-seq of cells expressing ZK643.3 can identify downstream transcriptional changes following receptor activation .

  • Proteomic characterization: Mass spectrometry-based approaches can identify:

    • Protein interaction partners through co-immunoprecipitation studies

    • Post-translational modifications induced by receptor signaling

    • Quantitative changes in cellular proteome after receptor activation

  • Peptidomic analysis: For identifying natural peptide ligands or signaling products:

    • Reduction and alkylation of cysteine residues improves detection of disulfide-rich peptides

    • LC-MS/MS analysis can identify naturally occurring peptides without trypsin digestion

    • Size fractionation separates candidate peptides into manageable analysis ranges

  • Combined data integration: Computational approaches that integrate multiple data types provide systems-level understanding of receptor function.

What structural biology approaches can determine ZK643.3 structure?

Structure determination requires specialized techniques:

  • Expression optimization for structural studies:

    • Engineering thermostabilizing mutations

    • Truncation of flexible regions that hinder crystallization

    • Fusion to crystallization chaperones like T4 lysozyme

  • Crystallization approaches:

    • Lipidic cubic phase crystallization specifically developed for membrane proteins

    • Co-crystallization with stabilizing antibodies or nanobodies

    • Screening diverse detergent and lipid conditions

  • Cryo-electron microscopy:

    • Sample preparation in nanodiscs or amphipols

    • Complex formation with signaling partners to increase particle size

    • Data collection and processing strategies specific to membrane proteins

Successful structure determination would allow detailed understanding of ligand binding sites and conformational changes associated with ZK643.3 activation .

How can I identify and validate novel ligands for ZK643.3?

Ligand discovery follows a systematic pathway:

  • In silico approaches:

    • Homology modeling based on related GPCRs with known structures

    • Virtual screening of compound libraries against the predicted binding pocket

    • Molecular dynamics simulations to identify stable binding modes

  • High-throughput screening:

    • Cell-based assays measuring canonical GPCR signaling (cAMP, calcium, β-arrestin)

    • Label-free technologies detecting cellular responses to receptor activation

    • Fragment-based screening approaches for initial hit identification

  • Validation hierarchy:

    • Dose-response relationships to establish potency

    • Competitive binding assays to confirm binding site interactions

    • Signaling profiling across multiple pathways to characterize biased agonism

    • Mutagenesis of predicted binding site residues to confirm interaction models

This systematic approach can identify both orthosteric and allosteric modulators of ZK643.3 function.

How can I characterize biased signaling properties of ZK643.3?

Analysis of biased signaling requires:

  • Pathway-specific assay development:

    • G-protein subtype-specific readouts (Gs/Gi/Gq/G12/13)

    • β-arrestin recruitment assays

    • Receptor internalization and trafficking measurements

  • Quantitative comparison framework:

    • Calculation of bias factors using operational models

    • Concentration-response curves across multiple pathways

    • Kinetic analysis of signaling activation and termination

  • Ligand structure-activity relationships:

    • Correlation between ligand structural features and signaling bias

    • Development of pathway-selective ligands

    • Molecular determinants of biased signaling

Understanding biased signaling helps identify ligands with targeted therapeutic potential and reduced side effects.

What are common challenges in ZK643.3 expression and how can they be addressed?

Common expression challenges include:

  • Low expression levels:

    • Systematically test different expression vectors, promoters, and host cell lines

    • Optimize induction conditions (temperature, time, inducer concentration)

    • Consider fusion partners known to enhance GPCR expression

  • Misfolding and aggregation:

    • Lower expression temperature to improve folding kinetics

    • Add chemical chaperones to culture media

    • Engineer stabilizing mutations or truncations

  • Poor membrane targeting:

    • Verify signal sequence functionality

    • Assess glycosylation status if applicable

    • Examine effect of fusion tags on trafficking

  • Post-translational modification issues:

    • Select expression systems capable of appropriate modifications

    • Consider engineering N-glycosylation sites if they affect expression or function

How can I resolve contradictory data from different ZK643.3 functional assays?

When assays produce conflicting results:

  • Assay mechanism analysis:

    • Different assays measure distinct aspects of receptor function

    • Proximity-based assays (BRET/FRET) detect molecular interactions while second messenger assays measure downstream effects

    • Temporal differences between assays may reflect pathway kinetics

  • Receptor expression level effects:

    • High overexpression can cause constitutive activity or pathway saturation

    • Compare results across varying expression levels

    • Normalize data to surface expression levels

  • Cell background considerations:

    • Endogenous signaling components vary between cell types

    • G-protein and arrestin expression levels differ across cell lines

    • Consider the impact of endogenous receptors forming heteromers

  • Systematic validation approach:

    • Use multiple, complementary assay technologies

    • Include appropriate positive and negative controls

    • Perform detailed time-course and dose-response analyses

What statistical approaches are most appropriate for analyzing ZK643.3 signaling data?

Proper statistical analysis should include:

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes

    • Randomization and blinding where applicable

    • Technical and biological replication strategy

  • Data normalization approaches:

    • Normalization to receptor expression levels

    • Internal controls for plate-to-plate variation

    • Appropriate baseline and maximum response controls

  • Statistical test selection:

    • Parametric vs. non-parametric based on data distribution

    • Correction for multiple comparisons when screening multiple conditions

    • Time-series analysis for kinetic data

  • Advanced modeling approaches:

    • Operational models for calculating signaling parameters

    • Allosteric interaction models for complex ligand responses

    • Systems biology models integrating multiple pathways

  • Visualization best practices:

    • Complete data presentation rather than selected examples

    • Appropriate error bars reflecting experimental variability

    • Clear indication of statistical significance and biological relevance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.