Recombinant Gadus morhua ATP synthase subunit a (mt-atp6)

Shipped with Ice Packs
In Stock

Description

Functional Role in ATP Synthesis

Subunit a (mt-atp6) is a core component of the F₀ domain of ATP synthase, responsible for proton translocation across the mitochondrial inner membrane. This process drives the rotation of the F₀-F₁ complex, enabling ATP synthesis from ADP. Key pathways involving mt-atp6 include:

PathwayRelated Proteins/ProcessesSource
Oxidative PhosphorylationATP5O, ATP6V0E1, SDHA, COX7B2
Alzheimer’s DiseaseBID, COX4I2, LRP1, NDUFA9
Parkinson’s DiseaseNDUFA3, CYCS, VDAC2, SLC25A4

Biochemical Assays

  • SDS-PAGE: Used to validate protein purity and structural integrity .

  • ELISA: Recombinant mt-atp6 serves as an antigen in enzyme-linked immunosorbent assays to detect antibodies or study immune responses .

Disease Modeling

Studies of human MT-ATP6 mutations (e.g., m.8993T>G) have utilized yeast models to assess pathogenicity. These models reveal that mutations in conserved residues (e.g., p.I106T, p.V142I) disrupt ATP synthase assembly and proton translocation, leading to ATP deficits .

Research Findings on Mutations and Pathogenicity

Mutation (Human)Yeast EquivalentBiochemical EffectSource
m.8843T>CaI123TATP production deficits, impaired assembly of ATP synthase complex
m.8950G>AaV159IReduced mitochondrial respiratory activity
m.9025G>AaG184SDecreased baseline respiration, increased ROS generation
m.9029A>GaH185RImpaired proton translocation, increased mitochondrial membrane potential

Key Observations:

  • Mutations in conserved residues (e.g., I106T, V142I) disrupt proton channel stability or complex assembly .

  • Severity correlates with heteroplasmy levels: symptomatic patients typically have >70% mutant mtDNA in affected tissues .

  • ATP hydrolysis capacity often remains intact, while ATP synthesis is selectively impaired .

Comparative Analysis with Human MT-ATP6

While Gadus morhua mt-atp6 shares structural and functional homology with human MT-ATP6 (UniProt P00846), key differences exist:

FeatureGadus morhua mt-atp6Human MT-ATP6
UniProt IDP55778P00846
Primary PathwayOxidative PhosphorylationOxidative Phosphorylation
Disease AssociationModel studies (limited data)NARP, Leigh syndrome, SLE
Expression SystemE. coliMitochondrial matrix

Challenges and Considerations

  • Protein Stability: Repeated freeze-thaw cycles degrade activity; storage at -20°C/-80°C is essential .

  • Heteroplasmy Complexity: Variable clinical outcomes in mitochondrial diseases complicate pathogenicity assessment .

  • Functional Assays: Yeast models remain critical for validating MT-ATP6 variants due to limited clinical testing options .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery times.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mt-atp6; atp6; atpase6; mtatp6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Gadus morhua (Atlantic cod)
Target Names
Target Protein Sequence
MTLSLFDQFSSPSFLGIPMILMALALPWLLIPTPTSRWLSNRVVSLQGWFIARFTNQLFL PLNVGGHKWAPLLASLMMFLLTLNMLGLMPYIFTPTTQLSLNLGLAVPLWLATVLIGMRN QPTHALGHFLPEGTPTALIPILIIMQTISLFIRPLALGVRLTANLTAGHLLIHLISSAVF VLMPMMPVVAILTAVLLLLLTMLEVAVAMIQAYVFILLLSLYLQENV
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane, generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the proton channel and may play a direct role in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Gadus morhua ATP synthase subunit a (mt-atp6) and why is it important in research?

ATP synthase subunit a (mt-atp6) from Gadus morhua (Atlantic cod) is a mitochondrial-encoded protein that forms a critical component of the ATP synthase complex (Complex V) in the inner mitochondrial membrane. This 227 amino acid protein plays an essential role in cellular energy production by facilitating proton translocation through the membrane, which drives ATP synthesis.

The protein is encoded by the mitochondrial gene mt-atp6, with synonyms including atp6, atpase6, and mtatp6 . Its importance in research stems from its highly conserved structure across species, making it valuable for evolutionary studies, and its role in mitochondrial diseases when mutated in humans. The recombinant form allows researchers to study structure-function relationships and pathogenic mechanisms without the complexities of whole mitochondrial systems.

How is mt-atp6 protein evolutionarily conserved, and what insights does this provide?

Mt-atp6 is highly conserved across vertebrate species, reflecting its essential role in energy metabolism. The conservation patterns in mt-atp6 sequences can provide insights into:

  • Functional domains critical for proton translocation

  • Evolutionary relationships among species, particularly in Salmonidae

  • Adaptation mechanisms to different environmental conditions

Studies of mitochondrial genomes in Salmonidae species have shown that mt-atp6 contains conserved regions that can be used for phylogenetic analysis and species identification . The gene's evolutionary history reveals how energy production mechanisms have been maintained while adapting to different ecological niches. Conservation analysis tools like SIFT have been used to evaluate the potential impact of mutations, with most pathogenic variants in highly conserved regions showing SIFT scores indicating "damaging" effects .

How is recombinant Gadus morhua mt-atp6 protein produced for research applications?

Recombinant Gadus morhua ATP synthase subunit a is typically produced using the following methodology:

  • Gene synthesis or cloning: The coding sequence (1-227aa) is synthesized or amplified from Gadus morhua mitochondrial DNA.

  • Expression vector construction: The sequence is inserted into a prokaryotic expression vector with an N-terminal His-tag for purification purposes.

  • Expression system: E. coli is the predominant expression system used for this hydrophobic membrane protein .

  • Induction and expression: Production is typically induced in bacterial culture under optimized conditions for membrane protein expression.

  • Purification: The protein is extracted using detergents and purified via nickel affinity chromatography utilizing the His-tag.

  • Final preparation: The purified protein is often formulated as a lyophilized powder in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 to maintain stability .

This approach yields recombinant protein suitable for various research applications, including structural studies, antibody production, and functional assays.

What are the optimal storage conditions for maintaining recombinant mt-atp6 stability?

Based on manufacturer recommendations for commercially available recombinant Gadus morhua mt-atp6 protein, the following storage protocols should be implemented :

  • Long-term storage: Store at -20°C/-80°C upon receipt.

  • Reconstitution: Prior to opening, briefly centrifuge the vial to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Working aliquots: Add glycerol to a final concentration of 50% and prepare multiple small aliquots to avoid repeated freeze-thaw cycles.

  • Short-term storage: Working aliquots can be stored at 4°C for up to one week.

  • Important precaution: Repeated freezing and thawing significantly reduces protein stability and should be avoided.

The addition of cryoprotectants like glycerol or trehalose (as seen in the storage buffer composition) helps maintain the native conformation of membrane proteins during freeze-thaw cycles and prevents aggregation.

What purification methods yield the highest purity of recombinant mt-atp6?

For optimal purification of recombinant Gadus morhua mt-atp6, a multi-stage approach is recommended:

  • Affinity chromatography: Utilizing the N-terminal His-tag for initial capture via nickel or cobalt resin affinity chromatography .

  • Size exclusion chromatography: To separate the correctly folded protein from aggregates and to exchange into the desired buffer system.

  • Ion exchange chromatography: As an optional polish step to remove contaminants with different charge properties.

  • Detergent optimization: Careful selection of detergents is critical for membrane protein purification. Mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) help maintain the native conformation.

The final product should achieve greater than 90% purity as determined by SDS-PAGE analysis . Purification success can be monitored through SDS-PAGE visualization and Western blotting using anti-His antibodies.

How can recombinant mt-atp6 be used to study mitochondrial disease mechanisms?

Recombinant mt-atp6 proteins serve as valuable tools for investigating mitochondrial disease mechanisms through several approaches:

  • Structural studies: Understanding how specific mutations affect protein folding and interaction with other ATP synthase subunits.

  • Functional reconstitution: Incorporating wild-type or mutant recombinant mt-atp6 into liposomes or nanodiscs to measure proton translocation and ATP synthesis activities.

  • Interaction studies: Investigating interactions between mt-atp6 and other subunits of ATP synthase, particularly subunit c, which is essential for proton translocation.

  • Antibody development: Generating specific antibodies against mt-atp6 for immunoprecipitation, immunohistochemistry, and Western blotting applications in disease studies.

Research has shown that mutations in human MT-ATP6 result in diverse biochemical features, including reduced ATP synthesis rate, preserved ATP hydrolysis capacity, and abnormally increased mitochondrial membrane potential . Recombinant proteins can help elucidate the molecular mechanisms behind these observations.

What techniques can be used to assess mt-atp6 functionality in vitro?

Several techniques can evaluate the functionality of recombinant mt-atp6 in vitro:

  • Proteoliposome reconstitution assays: Incorporating purified mt-atp6 into artificial lipid bilayers to measure:

    • Proton translocation using pH-sensitive fluorescent dyes

    • ATP synthesis rates with luciferin/luciferase assays

    • ATP hydrolysis through phosphate release assays

  • Membrane potential measurements: Using fluorescent dyes like TMRM or JC-1 to assess the ability of reconstituted mt-atp6 to maintain proton gradients.

  • Binding assays with other ATP synthase components, particularly:

    • Interaction with the c-ring (subunit c) using techniques like microscale thermophoresis

    • Studies of oligomycin binding, which specifically inhibits ATP synthase activity through interaction with subunit a

  • Structural analysis through:

    • Cryo-electron microscopy

    • Hydrogen/deuterium exchange mass spectrometry to probe conformational dynamics

These approaches have been valuable in characterizing the effects of mutations in human MT-ATP6, revealing that pathogenic variants often disrupt proton flow, ATP synthesis, or assembly of the ATP synthase complex .

How do researchers model pathogenic mt-atp6 mutations using recombinant proteins?

Researchers employ several strategies to model pathogenic mutations in mt-atp6:

  • Site-directed mutagenesis: Introduction of specific mutations identified in human patients into recombinant Gadus morhua mt-atp6 or other model species.

  • Heterologous expression systems:

    • Yeast models: Saccharomyces cerevisiae has been used extensively since mitochondrial genetic transformation can be achieved in a highly controlled fashion through biolistic delivery of in-vitro-made mutated mtDNA fragments .

    • Cybrid cell lines: Human cell lines where endogenous mtDNA is replaced with patient-derived mtDNA carrying mt-atp6 mutations .

  • Comparative functional analysis of:

    • Wild-type and mutant proteins

    • Different heteroplasmy levels (percentage of mutated mtDNA)

    • ATP synthesis and hydrolysis rates

    • Effects on mitochondrial membrane potential

Studies with these models have revealed that pathogenic MT-ATP6 variants result in diverse biochemical features. For instance, the common m.8993T>G mutation affects ATP synthesis by disrupting the salt bridge formation between subunits a and c, preventing rotor rotation after proton translocation .

How does Gadus morhua mt-atp6 compare with human mt-atp6, and what are the implications for research?

Comparative analysis of Gadus morhua and human mt-atp6 reveals several important features:

  • Sequence homology: While there are species-specific differences, the core functional domains involved in proton translocation show significant conservation, particularly in:

    • The critical arginine residue essential for the proton translocation mechanism

    • Transmembrane domains that form the proton channel

  • Structural differences:

    • Gadus morhua mt-atp6 is 227 amino acids in length

    • Human mt-atp6 contains slightly different membrane-spanning regions

  • Research implications:

    • Conservation of key functional residues allows fish mt-atp6 to serve as a model for human mt-atp6 function

    • Species-specific differences must be considered when extrapolating findings to human disease contexts

    • Comparative studies can reveal evolutionary adaptations in energy metabolism

  • Functional conservation: Despite sequence divergence, the fundamental mechanism of proton translocation coupling to ATP synthesis remains conserved, underscoring the evolutionary importance of this process .

These comparisons provide insights into both fundamental ATP synthase biology and species-specific adaptations in energy metabolism.

How can mt-atp6 sequencing be used for species identification and forensic applications?

Mt-atp6 has proven valuable for species identification and forensic applications due to several key properties:

  • Species-specific sequence patterns: The mt-atp6 gene contains regions that vary consistently between species while remaining conserved within species.

  • Forensic applications:

    • Food authentication: A study demonstrated that the mt-atp6 gene can be used for detecting rat meat contamination in food products using real-time PCR with specific primers and probes designed for Rattus norvegicus mt-atp6 .

    • Species identification: The mitochondrial genome composition, including mt-atp6, can be used to identify and differentiate between closely related salmonid species .

  • Technical approach:

    • Primer design targeting species-specific regions of mt-atp6

    • Real-time PCR with specific probes for rapid identification

    • Analysis of sequence variations to distinguish between closely related species

  • Advantages:

    • Mitochondrial genes like mt-atp6 exist in multiple copies per cell, improving detection sensitivity

    • The maternal inheritance pattern and lack of recombination make mitochondrial markers reliable for identification

These applications demonstrate the utility of mt-atp6 beyond basic biochemical research, extending to food safety, conservation, and forensic fields.

What human diseases are associated with MT-ATP6 mutations, and how are they studied?

Human MT-ATP6 mutations are associated with several mitochondrial disorders characterized by diverse clinical presentations:

  • Major clinical syndromes:

    • Leigh syndrome: A severe early-onset neurodegenerative disorder

    • NARP (Neuropathy, Ataxia, and Retinitis Pigmentosa): A syndrome characterized by neurological deterioration

    • MILS (Maternally Inherited Leigh Syndrome): Similar to Leigh syndrome but with maternal inheritance pattern

    • Various non-syndromic presentations: Including ataxia, neuropathy, and learning disabilities

  • Common pathogenic variants:

    • m.8993T>G - One of the first described human mitochondrial DNA diseases

    • m.8993T>C - Generally milder than the T>G mutation at the same position

    • m.9176T>C/G and m.9185T>C - Associated with Leigh syndrome and other presentations

  • Genotype-phenotype correlations:

    • Higher heteroplasmy levels (percentage of mutated mtDNA) typically correlate with more severe and earlier-onset disease

    • Leigh syndrome typically manifests at high heteroplasmy levels (≥90%), while other phenotypes are associated with lower levels

    • Maternal inheritance pattern is observed in most families, with variable penetrance

  • Research approaches:

    • Patient cohort studies correlating clinical features with specific mutations and heteroplasmy levels

    • Cybrid cell studies incorporating patient-derived mitochondria into standard nuclear backgrounds

    • Yeast models using homologous mutations in Saccharomyces cerevisiae

These disorders highlight the critical importance of ATP synthase in neurological function and provide models for understanding mitochondrial energy production.

What biochemical mechanisms underlie MT-ATP6-related diseases?

MT-ATP6 mutations disrupt ATP synthase function through several mechanisms, with variable biochemical consequences:

  • Primary biochemical defects observed in pathogenic variants include:

    • Decreased ATP synthesis rate (common with most variants)

    • Preserved ATP hydrolysis capacity (suggesting F₁ domain function is maintained)

    • Abnormally increased or decreased mitochondrial membrane potential

    • Altered assembly or stability of the ATP synthase complex

    • Increased reactive oxygen species (ROS) production

  • Mutation-specific mechanisms:

    MutationPrimary Biochemical EffectsProposed Mechanism
    m.8993T>GDecreased ATP synthesis, increased membrane potentialAbnormal salt bridge formation between subunits a & c preventing rotor rotation
    m.8993T>CDecreased ATP synthesis (milder than T>G)Abnormal structure of proton pore causing partial reduction of ATP synthesis
    m.9176T>GDecreased ATP synthesis, increased membrane potentialImpaired proton pumping efficiency with normal holocomplex
    m.9185T>CDecreased membrane potential, impaired complex assemblyImpairment of proton pump function
    m.9025G>ADecreased respiration, increased ROSAbnormal hydrogen bonding preventing conformational changes
  • Common pathophysiological pathways:

    • Disruption of proton translocation through the a/c subunit interface

    • Interference with the rotary mechanism coupling proton flow to ATP synthesis

    • Impaired assembly of the ATP synthase complex

    • Bioenergetic failure leading to cellular dysfunction and death

These biochemical insights help explain the tissue-specific effects of MT-ATP6 mutations, particularly in high-energy demanding tissues like the brain, retina, and muscle.

How does heteroplasmy influence the phenotypic expression of MT-ATP6 mutations?

Heteroplasmy—the coexistence of wild-type and mutant mtDNA within cells—significantly influences the clinical manifestations of MT-ATP6 mutations:

  • Threshold effect:

    • Clinical symptoms typically manifest only when heteroplasmy exceeds a certain threshold

    • This threshold appears to be variant-dependent, with some mutations (m.8993T>G, m.9176T>C, m.9185T>C) requiring very high heteroplasmy levels (>90%) to cause symptoms

    • Once threshold levels are breached, it becomes difficult to predict clinical phenotypes based solely on heteroplasmy levels

  • Tissue segregation patterns:

    • Different tissues can harbor varying levels of heteroplasmy

    • Postmitotic tissues like skeletal muscle, cardiac muscle, and neurons tend to accumulate higher levels of mutant mtDNA

    • Blood heteroplasmy levels may not accurately reflect levels in affected tissues

  • Progression over time:

    • Heteroplasmy levels can change over time in certain tissues

    • This can lead to age-dependent manifestation of symptoms or progression of disease severity

  • Research findings:

    • Meta-analysis demonstrated that heteroplasmy load was significantly higher in affected patients than their asymptomatic relatives (p=3.2×10^−45)

    • Earlier-onset phenotypes (like Leigh syndrome) typically show higher median heteroplasmy levels than later-onset phenotypes (like NARP)

    • Overlap exists in heteroplasmy levels between symptomatic and asymptomatic individuals, suggesting additional factors influence disease expression

These heteroplasmy dynamics have important implications for genetic counseling, including discussions around reproductive options for carriers of MT-ATP6 mutations .

What are the major challenges in expressing and purifying functional recombinant mt-atp6?

Researchers face several significant challenges when working with recombinant mt-atp6:

  • Membrane protein expression barriers:

    • High hydrophobicity leading to toxicity in expression hosts

    • Tendency to aggregate and form inclusion bodies

    • Difficult to achieve correct folding in heterologous systems

    • Challenges incorporating the protein into membranes

  • Purification complexities:

    • Requirement for detergents that maintain native structure while solubilizing the protein

    • Risk of protein denaturation during extraction from membranes

    • Difficulty in separating properly folded protein from aggregates

  • Functional assessment limitations:

    • mt-atp6 functions as part of a larger complex, making isolated functional studies challenging

    • Need for reconstitution into liposomes to assess proton translocation

    • Difficulty in reproducing the native lipid environment

  • Stability concerns:

    • Recombinant preparations require careful buffer optimization

    • Special storage conditions with cryoprotectants

    • Limited shelf life, with recommendations against repeated freeze-thaw cycles

These challenges necessitate specialized approaches and careful optimization of expression systems, purification protocols, and storage conditions to obtain functional protein for research applications.

How can researchers validate that recombinant mt-atp6 maintains its native conformation and function?

Validation of properly folded and functional recombinant mt-atp6 requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to evaluate secondary structure content

    • Limited proteolysis to assess protein folding

    • Thermal shift assays to determine protein stability

    • Size exclusion chromatography to verify monodispersity

  • Functional validation:

    • Reconstitution into liposomes or nanodiscs

    • Measurement of proton translocation using pH-sensitive dyes

    • Assessment of specific inhibitor binding (e.g., oligomycin)

    • Co-reconstitution with other ATP synthase components to evaluate assembly

  • Interaction studies:

    • Binding assays with known interaction partners (particularly subunit c)

    • Cross-linking studies to verify domain orientations and protein-protein contacts

    • Native gel electrophoresis to evaluate complex formation

  • Comparative analysis:

    • Parallel testing with native ATP synthase as a positive control

    • Comparison of wild-type and known mutant variants to establish functional benchmarks

These validation approaches are essential before using recombinant mt-atp6 in downstream research applications, as structural alterations could lead to misleading experimental results when studying this complex membrane protein.

What emerging technologies might advance our understanding of mt-atp6 structure and function?

Several cutting-edge technologies hold promise for deepening our understanding of mt-atp6:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy at atomic resolution to visualize mt-atp6 within the complete ATP synthase complex

    • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

    • Solid-state NMR to examine membrane protein structure in native-like environments

    • AlphaFold and other AI-based structure prediction tools to model interactions and conformational changes

  • Single-molecule techniques:

    • High-speed atomic force microscopy to visualize ATP synthase rotary motion in real-time

    • Single-molecule FRET to track conformational changes during proton translocation

    • Optical tweezers to measure mechanical forces generated during ATP synthesis

  • Innovative genetic approaches:

    • CRISPR-based mitochondrial DNA editing to introduce precise mutations

    • Development of better heteroplasmic animal models with controllable levels of mutant mtDNA

    • Single-cell sequencing to understand heteroplasmy distribution patterns

  • Systems biology integration:

    • Multi-omics approaches combining proteomics, metabolomics, and transcriptomics

    • Computational modeling of proton translocation energetics

    • Machine learning to identify patterns in disease presentation and progression

These technological advances could resolve longstanding questions about the precise mechanism of proton translocation through mt-atp6 and improve our understanding of how specific mutations disrupt this essential process.

How might research on mt-atp6 contribute to developing treatments for mitochondrial disorders?

Research on mt-atp6 could contribute to therapeutic strategies for mitochondrial disorders through several pathways:

  • Drug discovery targets:

    • Small molecules that enhance residual ATP synthase activity

    • Compounds that stabilize ATP synthase assembly in the presence of mutations

    • Agents that reduce abnormal ROS production resulting from mt-atp6 dysfunction

    • Modulators of mitochondrial membrane potential to optimize residual function

  • Gene therapy approaches:

    • Development of mitochondrially-targeted nucleases to selectively eliminate mutant mtDNA

    • Allotopic expression of mt-atp6 from the nucleus with mitochondrial targeting

    • RNA-based therapies to modulate heteroplasmy

  • Metabolic bypass strategies:

    • Identification of alternative energy production pathways that could compensate for ATP synthase deficiency

    • Metabolic modifiers that enhance glycolysis or other ATP-generating pathways

    • Targeted nutritional interventions based on detailed understanding of metabolic consequences

  • Biomarker development:

    • Identification of reliable biomarkers for disease progression

    • Personalized approaches based on specific mt-atp6 variants and heteroplasmy patterns

    • Development of assays to monitor treatment efficacy in clinical trials

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.