Recombinant Gadus morhua Cytochrome c oxidase subunit 2 (mt-co2)

Shipped with Ice Packs
In Stock

Description

General Information

Gadus morhua is the scientific name for Atlantic cod, a fish species of significant ecological and commercial importance . Recombinant Gadus morhua Cytochrome c Oxidase Subunit 2 (mt-co2) refers to the protein produced using recombinant DNA technology, where the gene encoding the Gadus morhua mt-co2 protein is expressed in a host organism such as E. coli .

Molecular Cloning and Expression

The process typically involves the following steps:

  1. Gene Cloning: The full-length cDNA of the COXII gene is isolated from Gadus morhua .

  2. Vector Insertion: The gene is then inserted into an expression vector, such as pET-32a .

  3. Host Cell Transformation: The expression vector is introduced into a host organism like E. coli for protein production .

  4. Induction of Expression: The expression of the COXII gene is induced using a substance like isopropyl β-d-thiogalactopyranoside (IPTG) .

  5. Protein Purification: The recombinant COXII protein, often with a tag like 6-His, is purified using affinity chromatography .

Characteristics of Cytochrome c Oxidase Subunit II (COX2)

  • COX2 contains a dual core CuA active site and is crucial for the function of the mitochondrial cytochrome c oxidase (Cco) .

  • It facilitates the transfer of electrons from cytochrome c to the binuclear center where oxygen is reduced to water .

  • The protein is highly conserved across species, indicating its fundamental importance .

Function and Role

COX2 is essential for cellular energy metabolism. It participates in the electron transfer process within the mitochondrial respiratory chain . This chain consists of multiple complexes that work together to transport electrons, ultimately leading to the reduction of oxygen and the creation of a proton gradient that drives ATP synthase .

Applications in Research

Recombinant Gadus morhua Cytochrome c Oxidase Subunit 2 (mt-co2) can be used in various research applications:

  • Enzyme Activity Studies: To assess the catalytic activity of COXII and its interactions with various substrates and inhibitors .

  • Structural Analysis: For determining the three-dimensional structure of the protein, providing insights into its function .

  • Evolutionary Studies: Comparing the COXII gene sequence across different species can provide insights into evolutionary relationships .

  • Toxicology: Assessing the impact of environmental contaminants on mitochondrial function by examining changes in COXII expression and activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mt-co2; coii; coxii; mtco2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Gadus morhua (Atlantic cod)
Target Names
Target Protein Sequence
MAHPSQLGFQDAASPVMEELLHFHDHALMIVFLISTLVLYIIVAMVSTKLTNKYILDSQE IEIIWTVLPAVILILIALPSLRILYLMDEINDPHLTIKAMGHQWYWSYEYTDYEDLGFDS YMIPTQDLAPGQFRLLEADHRMVVPVESPIRILISAEDVLHSWAVPALGIKMDAVPGRLN QTAFITSRPGVFYGQCSEICGANHSFMPIVVEAVPLEHFESWSSLMLEDA
Uniprot No.

Target Background

Function

Gadus morhua Cytochrome c oxidase subunit 2 (mt-co2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (Complex IV, CIV). These complexes collaborate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the CuA center (subunit 2) and heme a (subunit 1) to the active site (subunit 1), a binuclear center (BNC) comprising heme a3 and CuB. The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Cytochrome C Oxidase Subunit 2 in Gadus morhua?

Cytochrome C Oxidase Subunit 2 (MT-CO2) in Gadus morhua functions as a critical component of Complex IV in the mitochondrial respiratory chain, serving as the terminal electron acceptor in the process of oxidative phosphorylation. This protein contains copper centers that are essential for the electron transfer process and plays a rate-limiting role in cellular respiration, similar to its function in other vertebrates. The MT-CO2 subunit specifically participates in proton pumping across the inner mitochondrial membrane, contributing to the electrochemical gradient that drives ATP synthesis. In Atlantic cod, this protein is particularly significant for energy metabolism adaptation in response to environmental stressors such as temperature fluctuations and water chemistry changes that are common in their marine habitat. Studies in other species have demonstrated that COX2 can be involved in regulating energy consumption through its effects on the electron transfer rate, making it a potentially important adaptation factor for marine species facing environmental challenges .

What is the genetic structure of the MT-CO2 gene in Atlantic cod?

The MT-CO2 gene in Atlantic cod is encoded by the mitochondrial genome and exhibits characteristics typical of mitochondrial genes, including a high AT content and specific codon usage patterns. Similar to the COX2 gene analyzed in other species, the coding sequence is approximately 684 nucleotides long, encoding a protein of approximately 227 amino acids with highly conserved functional domains. The gene contains regions responsible for copper-binding sites that are essential for electron transfer functionality and demonstrates conservation in key catalytic residues across vertebrate species. While specific sequence data for Gadus morhua MT-CO2 was not provided in the search results, genomic studies on cod have been facilitated by ongoing genome sequencing efforts as part of integrative environmental genomics initiatives . These studies have enabled researchers to develop searchable expressed sequence tag (EST) databases that can be used to investigate the genetic structure and variation of mitochondrial genes including MT-CO2. The Atlantic cod genome project has opened possibilities for systems biology approaches to understanding molecular mechanisms of toxicity and environmental adaptation in this commercially important species.

How does the MT-CO2 sequence in Gadus morhua compare to other species?

Comparative analysis of MT-CO2 sequences across species reveals patterns of conservation and divergence that reflect both functional constraints and evolutionary adaptations. While specific sequence comparisons for Gadus morhua were not provided in the search results, studies of COX2 in other species like the giant panda have shown that this gene can have species-specific variations that may correlate with metabolic adaptations. In the giant panda study, researchers found that the COX2 gene showed evidence of being conserved throughout evolution but evolved differently in pandas compared to other Ursidae species . For Gadus morhua, similar comparative analyses would likely reveal conservation of functional domains involved in electron transport while showing species-specific variations in less functionally constrained regions. These comparative studies are particularly valuable for understanding how different fish species adapt to varying environmental conditions. The conservation pattern typically observed in MT-CO2 genes reflects the critical nature of this protein in cellular respiration, with greatest sequence identity in regions containing metal-binding sites and catalytic domains. Researchers working with recombinant Gadus morhua MT-CO2 should note that even small species-specific variations in amino acid sequence could have significant implications for protein function and environmental adaptation.

What purification protocols yield the highest purity of recombinant MT-CO2?

A multi-step purification strategy incorporating both affinity chromatography and polishing steps typically yields the highest purity for recombinant MT-CO2 protein. For His-tagged recombinant MT-CO2, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin serves as an effective initial capture step, similar to the approach used for other recombinant MT-CO2 proteins . Following initial capture, size exclusion chromatography (SEC) effectively separates the target protein from aggregates and lower molecular weight contaminants, while ion exchange chromatography can further remove proteins with different charge properties. For membrane-associated proteins like MT-CO2, purification in the presence of mild detergents (such as n-dodecyl β-D-maltoside or CHAPS) helps maintain protein solubility and native conformation throughout the purification process. Based on protocols for similar proteins, purification should be conducted at 4°C with protease inhibitors to prevent degradation, and buffers should be optimized to maintain protein stability, typically using Tris or phosphate-based systems at pH 7.5-8.0 with 6-10% trehalose as a stabilizing agent . Final purity assessment should be performed using SDS-PAGE, with successful protocols typically achieving greater than 90% purity as determined by densitometric analysis, consistent with the standards reported for other recombinant mitochondrial proteins.

How can the activity of recombinant MT-CO2 be verified after expression?

Verification of recombinant MT-CO2 activity requires a combination of structural integrity assessment and functional assays that evaluate its electron transport capability. First, circular dichroism (CD) spectroscopy should be employed to confirm proper secondary structure formation, while thermal shift assays can assess protein stability under various buffer conditions. For functional verification, oxygen consumption measurements provide the most direct assessment of cytochrome c oxidase activity, using a Clark-type oxygen electrode or more advanced respirometry techniques to measure the rate of oxygen reduction in the presence of reduced cytochrome c and the recombinant MT-CO2. Spectrophotometric assays tracking the oxidation of reduced cytochrome c at 550 nm can provide a convenient alternative for quantitative activity measurement. Additionally, copper incorporation, which is essential for MT-CO2 function, can be verified using atomic absorption spectroscopy or inductively coupled plasma mass spectrometry (ICP-MS). Protein reconstitution into liposomes or nanodiscs may be necessary to create a membrane-like environment for optimal activity assessment, particularly for evaluating proton pumping functionality. Researchers should develop a standard activity unit definition based on these assays to enable quantitative comparison between different preparation batches and with native protein activity levels.

How can recombinant MT-CO2 be used to study environmental adaptation in Atlantic cod?

Recombinant MT-CO2 provides a powerful tool for investigating how Atlantic cod adapt to changing environmental conditions, particularly in response to ocean acidification and temperature fluctuations. By expressing variants of MT-CO2 identified from cod populations living in different environmental conditions, researchers can conduct comparative enzymatic assays to determine how sequence variations affect protein stability, electron transfer efficiency, and proton pumping under controlled laboratory conditions simulating environmental stressors. These functional studies can be correlated with physiological data on whole organism responses to stressors, establishing mechanistic links between molecular adaptations and organismal fitness. The transporters associated with acid-base regulation in fish gills, which include Na⁺-HCO₃⁻ cotransporters like SLC4a4 (NBC1), are known to show differential expression in response to elevated CO₂ levels . Studies combining recombinant MT-CO2 activity with analysis of these acid-base regulatory mechanisms can provide integrated insights into how energy metabolism and acid-base regulation coordinate during environmental adaptation. This research approach is particularly valuable given that Atlantic cod is both an essential species in North Atlantic fisheries and increasingly relevant as an aquaculture species, making it important to understand how industrial effluents and environmental changes affect their growth, reproduction, and health .

What are the implications of MT-CO2 variations for understanding metabolic efficiency in fish?

Variations in MT-CO2 sequence and structure have significant implications for understanding metabolic efficiency in fish species like Gadus morhua, particularly in the context of environmental adaptation and energy allocation strategies. By analyzing the kinetic properties of recombinant MT-CO2 variants, researchers can determine how specific amino acid substitutions influence the efficiency of electron transfer and oxygen consumption rates, which directly impact ATP production. These molecular-level differences in MT-CO2 function can help explain population-level variations in metabolic rate, thermal tolerance, and adaptation capacity observed in different cod populations. For example, studies in giant pandas have shown that conservation of COX2 structure and function might be related to their lower energy intake and slower movement compared to other Ursidae species . Similar principles may apply to fish populations adapted to different thermal regimes or food availability patterns. Recombinant MT-CO2 variants can be used in biochemical assays measuring the P/O ratio (ATP produced per oxygen consumed) to quantify energetic efficiency differences that may provide selective advantages in specific environments. This research connects molecular evolution to whole-organism energetics, offering insights into how climate change might affect species distribution and abundance through direct effects on metabolic efficiency.

How can structural studies of recombinant MT-CO2 inform evolutionary biology research?

Structural studies of recombinant Gadus morhua MT-CO2 provide valuable insights into evolutionary processes and adaptive mechanisms in marine species. By determining the three-dimensional structure of the protein through X-ray crystallography or cryo-electron microscopy, researchers can identify structurally conserved regions that likely face strong purifying selection due to functional constraints versus regions showing greater structural variation that may be targets of adaptive evolution. These structural data, when integrated with comparative sequence analyses across multiple fish species, enable the identification of positively selected sites that may confer adaptive advantages in specific environmental conditions. Studies on COX2 in the giant panda demonstrated how neutrality tests like Tajima's D and Fu's Fs, combined with dN/dS ratio analysis, can reveal evolutionary patterns such as population bottlenecks or positive selection . Similar approaches applied to Atlantic cod MT-CO2 can illuminate how evolutionary processes have shaped metabolic adaptation in marine environments. The structural consequences of MT-CO2 variants can be evaluated through computational modeling to predict functional effects before experimental validation, allowing researchers to connect sequence evolution, protein structure, biochemical function, and organismal fitness in a comprehensive evolutionary framework.

What are common issues in expressing functional MT-CO2 and how can they be addressed?

Researchers frequently encounter several challenges when expressing functional recombinant MT-CO2 from Gadus morhua, with protein misfolding and inclusion body formation being among the most common issues. To address inclusion body formation in E. coli expression systems, protocols should be modified to include lower induction temperatures (16-20°C), reduced inducer concentrations, and co-expression with molecular chaperones such as GroEL/GroES or DnaK/DnaJ/GrpE to facilitate proper folding. For proteins expressed as inclusion bodies, optimization of refolding protocols using gradual dialysis with decreasing concentrations of denaturants (urea or guanidine hydrochloride) in the presence of stabilizing agents can improve recovery of functional protein. Another significant challenge is the incorporation of copper cofactors essential for MT-CO2 function, which can be addressed by supplementing growth media with copper salts and including copper in purification buffers. Codon usage bias between E. coli and Gadus morhua can lead to translational stalling and incomplete protein synthesis; this can be mitigated by using codon-optimized synthetic genes or E. coli strains engineered to express rare codons. Low expression levels may necessitate optimization of vector elements including promoters, ribosome binding sites, and termination sequences, or exploring alternative expression systems as detailed in section 2.1. Protein toxicity to host cells can be managed using tightly regulated inducible expression systems or secretion of the protein to the periplasmic space to reduce intracellular accumulation.

How can researchers overcome solubility problems with recombinant MT-CO2?

Solubility issues with recombinant MT-CO2 from Gadus morhua require systematic optimization strategies focusing on both expression conditions and buffer compositions. During expression, fusion partners known to enhance solubility, such as maltose-binding protein (MBP), thioredoxin (TRX), or SUMO, can significantly improve the proportion of soluble protein compared to traditional His-tags alone. For purification and storage, buffer optimization is critical, with the inclusion of 6-10% trehalose in Tris or phosphate-based buffers (pH 7.5-8.0) shown to be effective for similar proteins . Membrane proteins like MT-CO2 often require detergents to maintain solubility; screening different detergents (ranging from harsh ionic detergents like SDS to milder non-ionic options like DDM or digitonin) at concentrations above their critical micelle concentration is essential for identifying optimal conditions. Additives such as glycerol (10-20%), arginine (50-100 mM), or low concentrations of reducing agents like DTT or β-mercaptoethanol can further enhance protein solubility by preventing aggregation. For long-term storage, lyophilization of the purified protein in the presence of appropriate cryoprotectants has proven effective for similar proteins, though researchers should avoid repeated freeze-thaw cycles which can significantly reduce protein activity . When reconstituting lyophilized protein, gradual addition of deionized sterile water to achieve concentrations of 0.1-1.0 mg/mL, followed by addition of glycerol (final concentration 5-50%) and aliquoting for storage at -20°C/-80°C, can help maintain protein integrity for extended periods.

What emerging techniques might enhance MT-CO2 research?

Several cutting-edge techniques are poised to revolutionize MT-CO2 research in Gadus morhua and other marine species. CRISPR-Cas9 genome editing technologies offer unprecedented opportunities to create precise modifications in the MT-CO2 gene within cellular models, enabling direct testing of how specific sequence variations affect protein function and cellular physiology. Single-molecule enzymology techniques can now reveal the dynamic behavior of individual MT-CO2 molecules during the catalytic cycle, providing insights into mechanistic details not accessible through bulk measurements. Advanced structural biology approaches, including cryo-electron microscopy and time-resolved X-ray crystallography, are increasingly capable of capturing MT-CO2 in different conformational states during electron transfer, potentially revealing species-specific adaptations in protein dynamics. Integrative multi-omics approaches that combine proteomics, transcriptomics, and genomics data can place MT-CO2 function within broader cellular networks, as exemplified by toxicogenomic studies of Atlantic cod that have developed searchable EST databases and genomic databases . These interdisciplinary approaches open new possibilities for gene annotation and pathway analyses. Computational methods including molecular dynamics simulations and machine learning algorithms trained on existing protein functional data are becoming increasingly valuable for predicting how sequence variations might affect protein stability and function in different environmental contexts. These emerging techniques, when applied to Gadus morhua MT-CO2, will enable researchers to connect molecular mechanisms to ecological outcomes in increasingly sophisticated ways.

How might MT-CO2 studies contribute to understanding climate change impacts on marine species?

Research on Gadus morhua MT-CO2 offers crucial insights into potential physiological impacts of climate change on commercially important fish species, particularly regarding ocean acidification and warming. Studies examining how recombinant MT-CO2 function is affected by pH and temperature variations can help predict metabolic responses of Atlantic cod populations to changing ocean conditions, where increasing CO₂ levels lead to physiological challenges. The transport of bicarbonate ions across gill membranes, mediated by transporters like the Na⁺-HCO₃⁻ cotransporter (NBC1), has been shown to respond differentially to elevated CO₂ pressure depending on exposure level, duration, developmental stage, and species . Integrating MT-CO2 functional studies with analyses of these acid-base regulatory mechanisms can provide a comprehensive understanding of how energy metabolism adjusts to environmental stressors. Comparing MT-CO2 sequences and functional properties across cod populations from different thermal regimes may reveal adaptive variations that could indicate which populations possess greater resilience to climate change. This information is valuable for fisheries management and conservation efforts aimed at preserving genetic diversity that may be crucial for species adaptation. Additionally, recombinant MT-CO2 could serve as a biomarker in environmental monitoring programs, with functional assays potentially providing early warning signs of metabolic stress in fish populations exposed to changing environmental conditions. These research directions align with the growing need for systems toxicology approaches to understand how environmental insults affect commercially important marine species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.