Recombinant Gadus morhua Melanopsin-A (opn4a)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Gadus morhua Melanopsin-A (opn4a) was first isolated and characterized in 2003 through genomic and transcriptomic analyses of Atlantic cod tissues . Key features include:

PropertyDetail
Gene StructureContains 10 exons and 9 introns, spanning ~11.8 kb in the genome .
Protein ClassG-protein-coupled receptor (GPCR) with seven transmembrane domains .
Chromophore BindingUtilizes retinaldehyde, forming a Schiff-base linkage at Lys296 .
Spectral SensitivityPeak sensitivity in blue-light spectrum (~470–484 nm) .

Expression and Localization

opn4a is differentially expressed in retinal and extraretinal tissues, as demonstrated via in situ hybridization and immunohistochemistry :

Retinal Expression

  • Inner Retina: Localized in subsets of amacrine and ganglion cells.

  • Horizontal Cells: Unique to opn4a, distinguishing it from opn4b .

Brain Expression

  • Suprachiasmatic Nucleus (SCN): Key site for circadian rhythm regulation .

  • Habenula: Implicated in photic integration and behavioral responses .

Non-Visual Photoreception

  • Circadian Entrainment: Mediates light input to the SCN, synchronizing biological rhythms .

  • Neuroendocrine Regulation: Modulates hypophysiotrophic systems (e.g., melatonin secretion) .

Comparative Physiology

Featureopn4aopn4b
Retinal LocalizationHorizontal, amacrine, ganglion cellsGanglion cells only
Brain TargetsSCN, habenulaHabenula, lateral hypothalamus
Evolutionary OriginConserved in teleosts and tetrapods Teleost-specific duplication

Key Studies

  1. Differential Signaling Pathways

    • opn4a activates Gq/11-mediated phototransduction, increasing intracellular calcium via phospholipase C (PLC) .

    • Unlike mammalian melanopsins, opn4a retains invertebrate-like bistable photochemistry, enabling light-dependent isomerization without chromophore dissociation .

  2. Developmental Roles

    • In zebrafish homologs, opn4m genes (analogous to opn4a) are expressed in horizontal cells, suggesting roles in retinal circuit maturation .

  3. Therapeutic Implications

    • Melanopsin activation via blue light reduces vascular pathology in oxygen-induced retinopathy models, suggesting potential for treating retinopathy of prematurity .

Evolutionary Context

opn4a belongs to the opn4m lineage, which diverged from opn4x early in vertebrate evolution . Its conservation across teleosts (e.g., Atlantic cod, zebrafish) and tetrapods (e.g., Xenopus, mice) underscores its role in ancestral photic systems .

Technical Applications

  • AAV-Based Tracing: Recombinant opn4a-expressing vectors (e.g., AAV-flex-plap) enable mapping of retinofugal projections to brain regions like the amygdala and hypothalamus .

  • Calcium Imaging: Used to study light-evoked responses in ipRGCs and horizontal cells .

Unresolved Questions

  • Chromophore Recycling: Mechanisms differ from mammalian melanopsins, warranting further study .

  • Behavioral Outputs: Specific contributions to phototaxis and predator avoidance in cod remain uncharacterized .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
opn4a; Melanopsin-A; Opsin-4A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-561
Protein Length
full length protein
Species
Gadus morhua (Atlantic cod)
Target Names
opn4a
Target Protein Sequence
MRPSTDTMEADTAATHRNFITKVDVPDHAHYTVAFFVSVIGTLGVTGNALVQFAFYSNKK LRNLPNYFIMNQAASDFLMAFTQSPFFFINCLNREWIFGELGCKLYAFLGALFGITSMIN LLAISLDRYMVITRPLEAMKWNSKRRTTIAILLVWLYSLAWSLAPLVGWSSYIPEGLRTS CTWDYVTYTASNRSYTMMLCCFVFFIPLAIISYCYLFMFLAIRKTSRDVERLGIQVRKST IIRQKSIRTEWKLAKIAFVVIVVYVLSWSPYACVTMISWSGHANILSPYSKTVPAVIAKA STIYNPFIYAIIHQKYRKTLADKVPCLRFLAPNKRKDCTSSSFSGSSYRDSVISRTSTAI RRQSTAASRHASASKTAAGASSYSSSDRVFGDVEMDPIDWRSGASFRRHSSRGSTRRDRL LKKQQMERTNKSAAHKQPSPSTKMSATHCKNKTVSSSVNMAAAPPQLVLIRKRSQSLTNG LSDAGKKTTVANGTPGNHKSKSADLHFRNLPALDQALNVPRIIVISPTSEDCLVKHESSF TDDGSVGTVVDEDSLEDNDVV
Uniprot No.

Target Background

Function
Melanopsin, encoded by the *opn4a* gene, is a photoreceptor involved in non-image-forming light responses. It plays a crucial role in regulating various physiological processes, including circadian rhythms and pupillary light reflex.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in retina and brain. Expressed in a subset of retinal horizontal cells as well as a small number of amacrine and retinal ganglion cells. Also expressed in a small population of neurons in the suprachiasmatic nucleus (SNC).

Q&A

What is Melanopsin-A (opn4a) and how was it discovered in Atlantic cod?

Melanopsin-A (opn4a) is one of two melanopsin photopigments isolated and characterized from Atlantic cod (Gadus morhua). It belongs to a subgroup of melanopsins that also includes members from Xenopus, chicken, and Takifugu. Melanopsin was initially discovered as a novel photopigment involved in regulating circadian rhythms in tetrapods, with the first two teleost melanopsins (opn4a and opn4b) being isolated specifically from Atlantic cod . The characterization involved molecular cloning techniques and in situ hybridization studies to determine expression patterns. Melanopsin-A functions as a photoreceptive protein that confers light sensitivity to specific cell types and is involved in non-visual photoreceptive tasks .

How does Melanopsin-A (opn4a) differ from Melanopsin-B (opn4b) in Atlantic cod?

While both Melanopsin-A (opn4a) and Melanopsin-B (opn4b) belong to the same photopigment family, they demonstrate distinct expression patterns and likely serve different physiological functions:

FeatureMelanopsin-A (opn4a)Melanopsin-B (opn4b)
Expression in retinaInner retina (amacrine and ganglion cells) and horizontal cellsInner retina (amacrine and ganglion cells) only
Brain expressionSuprachiasmatic nucleusHabenula
Proposed functionEntrainment of circadian rhythms and hypophysiotrophic systemsIntegration of photic inputs from pineal and other brain regions

The differential expression pattern suggests that opn4a has additional roles beyond those served by opn4b, particularly due to its expression in horizontal cells . The suprachiasmatic nucleus, where opn4a is expressed, is a major center for circadian rhythm regulation, while the habenula, where opn4b is expressed, integrates photic inputs from various brain regions .

What is the amino acid sequence and structure of recombinant Gadus morhua Melanopsin-A?

The recombinant Gadus morhua Melanopsin-A (opn4a) consists of 561 amino acids with a full expression region spanning positions 1-561. The amino acid sequence begins with MRPSTDTMEADTAATHRNFITK and includes characteristic features of opsins, such as seven α-helical transmembrane regions . These transmembrane domains form a bundle within the membrane, creating a binding cavity for the chromophore retinal, which is essential for light detection .

Similar to other G-protein-coupled receptors, Melanopsin-A contains three intracellular loops and three extracellular loops that connect the transmembrane segments. The protein exhibits structural features necessary for photoreception and subsequent signal transduction .

How is Melanopsin-A expression detected in tissue samples?

Detection of Melanopsin-A expression in tissue samples typically employs in situ hybridization techniques using digoxigenin-labeled riboprobes specific to the melanopsin gene sequence. This approach has been successfully demonstrated in studies of other vertebrate melanopsins . When applying this technique:

  • Tissue sections (typically retinal or brain) are fixed and prepared for hybridization

  • Antisense riboprobes specific to the opn4a sequence are generated

  • Hybridization is conducted under optimized temperature and buffer conditions

  • Visualization is achieved using anti-digoxigenin antibodies coupled with colorimetric detection

In studies with marsupial melanopsin, this technique revealed expression restricted to a subset of cells in the ganglion cell layer, with occasional staining in the inner nuclear layer attributed to displaced ganglion cells . For quantitative distribution analysis, the technique can be applied to flat-mounted retinae to determine the density and distribution pattern of melanopsin-positive cells .

What experimental approaches can be used to study Melanopsin-A function in circadian rhythm regulation?

Investigating Melanopsin-A's role in circadian rhythm regulation requires a multi-faceted experimental approach:

MethodologyApplicationTechnical Considerations
Gene knockout/knockdownDetermine phenotypic effects of opn4a absenceMay require CRISPR-Cas9 for teleost models; consider potential compensation by opn4b
ElectrophysiologyMeasure light-induced responses in melanopsin-expressing cellsRequires identification of cells using transgenic labeling or post-recording immunohistochemistry
Calcium imagingVisualize cellular activation in response to light stimuliCan be combined with optogenetic tools for pathway dissection
Behavioral assaysMeasure circadian activity patternsRequires specialized equipment for long-term activity monitoring in aquatic species
Molecular chronobiologyAssess effects on clock gene expressionTime-series sampling critical; consider ZT (zeitgeber time) standardization

When designing experiments to study suprachiasmatic nucleus function, where opn4a is expressed, it's essential to consider the neural pathways that connect light input to circadian output. The conserved expression pattern between cod and Xenopus suggests evolutionary conservation of melanopsin function in non-visual photoreception .

What are the challenges in expressing and purifying functional recombinant Melanopsin-A?

Expressing and purifying functional Melanopsin-A presents several significant challenges that researchers must address:

  • Membrane protein expression: As a seven-transmembrane domain protein, Melanopsin-A is difficult to express in soluble form and often aggregates when overexpressed.

  • Post-translational modifications: Proper folding may require specific post-translational modifications that vary between expression systems.

  • Chromophore integration: Functional melanopsin requires correct incorporation of the retinal chromophore, which must be supplied during or after protein expression.

  • Detergent selection: Extracting membrane proteins requires careful selection of detergents that maintain protein structure while effectively solubilizing it from membranes.

  • Stability considerations: Purified Melanopsin-A has limited stability and requires specific storage conditions: -20°C for standard storage, -20°C or -80°C for extended storage, with 50% glycerol in Tris-based buffer .

When working with recombinant Melanopsin-A, it's recommended to avoid repeated freezing and thawing cycles and to store working aliquots at 4°C for no more than one week . The tag type for purification is typically determined during the production process to optimize yield and functionality .

How does the third intracellular loop of Melanopsin-A influence G-protein coupling and signaling?

The third intracellular loop of opsins is critically important for G-protein interaction and activation of phototransduction cascades. Comparison studies revealed interesting evolutionary patterns in this functional domain:

Species ComparisonThird Intracellular Loop IdentityPotential Functional Implication
Dunnart vs. Opossum (marsupials)77% identityHigher conservation between marsupial species
Human vs. Mouse (placentals)65% identityGreater divergence between placental mammals
Rod opsin (across species)100% identityComplete conservation in visual opsins

The unexpectedly high variability in the melanopsin third intracellular loop raises important research questions :

  • Can melanopsin accommodate an unusually high number of variations in this region while maintaining function?

  • Does melanopsin signal through different G-protein pathways in different species?

  • Is the third intracellular loop as critical for melanopsin G-protein interaction as it is for other opsins?

These questions highlight important areas for future research on signaling mechanisms and evolutionary adaptation in melanopsin function across vertebrate lineages.

What approaches can be used to compare evolutionary conservation of Melanopsin-A across species?

Evolutionary analysis of Melanopsin-A requires sophisticated comparative genomics approaches:

  • Sequence alignment and phylogenetic analysis: Multiple sequence alignment of melanopsin genes from diverse vertebrate species can reveal evolutionary relationships and rates of sequence divergence. Interestingly, studies of marsupial melanopsins showed higher sequence identity between Australian and South American marsupials than between human and mouse, despite similar divergence times (65-85 million years ago) .

  • Synteny analysis: Examining the conservation of gene order and chromosomal position can provide insights into evolutionary history. Such analyses contributed to the discovery that the Opn4x gene (present in non-mammalian vertebrates) was likely lost before the placental/marsupial split .

  • Positive selection testing: Statistical tests like dN/dS ratios can identify regions under positive or purifying selection, revealing functionally important domains.

  • Protein structure modeling: Homology-based structural models can predict how sequence variations affect protein function across species.

When conducting comparative analyses, it's important to note that melanopsin genes in non-mammalian vertebrates exist in two forms (Opn4m and Opn4x), while mammals retain only the Opn4m form . This evolutionary pattern suggests specific selective pressures on melanopsin genes during vertebrate evolution.

What is the cellular distribution of Melanopsin-A in the Atlantic cod retina?

In the Atlantic cod retina, Melanopsin-A (opn4a) exhibits a specific cellular distribution pattern:

  • Inner retina: Expression is found in a subset of cells resembling amacrine and ganglion cells in both larval and adult retinas .

  • Horizontal cells: Uniquely, opn4a is also expressed in horizontal cells, which is not observed for opn4b. This distinctive expression pattern suggests a separate function for opn4a in these cells .

This distribution pattern indicates multiple potential roles for Melanopsin-A in the retina, potentially including both direct photoreception and modulation of visual signaling pathways. The expression in horizontal cells is particularly noteworthy as these cells typically function in lateral inhibition within the retina, suggesting Melanopsin-A may play a role in light-dependent modulation of traditional visual pathways .

How does brain expression of Melanopsin-A differ from Melanopsin-B in Atlantic cod?

The expression patterns of Melanopsin-A and Melanopsin-B in the Atlantic cod brain show clear regional specificity:

Brain RegionMelanopsin-A (opn4a)Melanopsin-B (opn4b)Functional Significance
Suprachiasmatic nucleusExpressedNot detectedCenter for circadian rhythm regulation
HabenulaNot detectedExpressedIntegration of photic inputs from pineal and other brain regions

This differential expression in the brain is particularly interesting because both regions are major photosensitive integration centers but serve different functions . The suprachiasmatic nucleus, where opn4a is expressed, is known to be involved in circadian rhythm regulation, similar to melanopsin expression patterns found in Xenopus. This conservation suggests an evolutionarily preserved role for Melanopsin-A in non-visual photoreception related to circadian entrainment .

The habenula, expressing only opn4b, integrates photic inputs from the pineal and other brain regions, potentially serving as an additional photoreception center in teleosts .

What are the optimal storage and handling conditions for recombinant Melanopsin-A?

To maintain the structural integrity and functionality of recombinant Gadus morhua Melanopsin-A, researchers should adhere to these storage and handling guidelines:

ParameterRecommendationResearch Consideration
Storage temperature-20°C for standard storage; -20°C or -80°C for extended storageLower temperatures reduce protein degradation and maintain functional conformation
Buffer compositionTris-based buffer with 50% glycerolGlycerol prevents freeze damage and stabilizes protein structure
Freeze-thaw cyclesAvoid repeated freezing and thawingEach cycle can reduce protein activity; aliquot upon receipt
Working storageStore working aliquots at 4°C for up to one weekBalance convenience with stability requirements

These conditions are optimized specifically for recombinant Melanopsin-A and may differ from requirements for other recombinant proteins . The high glycerol concentration (50%) is particularly important for maintaining the stability of membrane proteins like melanopsin.

What controls should be included in melanopsin expression studies?

When conducting expression studies for Melanopsin-A, proper controls are essential for result validity:

  • Negative controls:

    • Sense probe controls for in situ hybridization experiments

    • Secondary antibody-only controls for immunohistochemistry

    • Isotype controls for flow cytometry

    • No-template controls for PCR

  • Positive controls:

    • Known melanopsin-expressing tissues (e.g., specific retinal regions)

    • Recombinant protein standards for Western blots

    • Validated cell lines with confirmed melanopsin expression

  • Validation approaches:

    • Multiple detection methods (e.g., PCR plus protein detection)

    • Cross-species validation using conserved domains

    • Functional validation through light response assays

In studies of marsupial melanopsin, for example, researchers used sense probes as negative controls for in situ hybridization, which showed no staining compared to the specific signal observed with antisense probes . This control approach is essential for confirming the specificity of detected signals.

What are promising areas for future research on Gadus morhua Melanopsin-A?

Several promising research directions could advance our understanding of Melanopsin-A function in Atlantic cod:

  • Comparative signaling pathway analysis: Investigating whether the divergent third intracellular loop sequences observed across species lead to different G-protein coupling preferences or downstream signaling pathways.

  • Horizontal cell function: Exploring the unique role of Melanopsin-A in horizontal cells, which could represent a novel mechanism for light-dependent modulation of visual processing.

  • Environmental adaptation: Studying how Melanopsin-A function relates to the specific light environments experienced by Atlantic cod throughout their life history and habitat range.

  • Circadian biology applications: Developing cod as a model system for understanding circadian biology in marine species, particularly in contexts of climate change and shifting light regimes.

  • Cross-species comparative studies: Expanding on the observation that two teleost melanopsin genes (opn4a and opn4b) exist compared to the single form in mammals, to better understand the evolutionary pressures that shaped vertebrate non-visual photoreception .

These research directions would build upon the foundational understanding of Melanopsin-A distribution and function while addressing important gaps in our knowledge about non-visual photoreception in aquatic vertebrates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.