Recombinant Gadus morhua Melanopsin-B (opn4b)

Shipped with Ice Packs
In Stock

Description

Gene Expression and Localization

The opn4b gene exhibits differential expression patterns in Atlantic cod:

  • Retinal Expression: Detected in the inner nuclear layer, primarily in amacrine and ganglion cells .

  • Brain Expression: Expressed in retinal and extraretinal photosensitive integration centers, distinct from opn4a .

  • Developmental Profile: Present in larval and adult retinas, with conserved expression patterns across life stages .

Key Functional Implications:

  • Circadian Regulation: Likely involved in light detection for circadian entrainment, similar to mammalian ipRGCs (intrinsically photosensitive retinal ganglion cells) .

  • Non-Image-Forming Vision: May contribute to photoreceptive functions independent of cone/rod pathways, such as light-dependent calcium signaling .

Functional Studies and Research Findings

Experimental insights into opn4b’s roles include:

  • Phototransduction:

    • Melanopsin enhances contrast sensitivity in ipRGCs via Gq-coupled signaling, critical for visual processing .

    • In opn4b-expressing cells, light induces calcium influx, mimicking mammalian ipRGC behavior .

  • Developmental Roles:

    • Ablation of ipRGCs (including opn4b-expressing cells) disrupts retinogeniculate map refinement, highlighting its role in visual circuit development .

Comparative Analysis with Other Melanopsins

Featureopn4b (Gadus morhua)Mammalian Opn4
Gene FamilyTeleost-specific subgroupMammalian-like (Opn4m)
Expression SitesInner retina, brainRetinal ganglion cells
Light SensitivityBlue light (λ ~480 nm) Blue light (λ ~480 nm)
Functional TargetsCircadian nuclei, thalamusSuprachiasmatic nucleus, dLGN

Research Gaps and Future Directions

  • Mechanistic Studies: Limited data on opn4b’s interaction with downstream signaling pathways in teleosts.

  • Behavioral Relevance: Role in fish-specific behaviors (e.g., schooling, predator avoidance) remains unexplored.

  • Therapeutic Potential: Recombinant opn4b could model retinal dystrophies or aid in developing light-based therapies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer requirements.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
opn4b; Melanopsin-B; Opsin-4B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-615
Protein Length
full length protein
Species
Gadus morhua (Atlantic cod)
Target Names
opn4b
Target Protein Sequence
MDMDRGFYRKVDVPDHAHYVIAFFVLIIGVVGVTGNALVMYAFLCNKKLRTPPNYFIMNL AVSDFLMAITQSPIFFINSLFKEWIFGETGCRMYAFCGALFGITSMINLLAISLDRYIVI TKPPQAIRWVSGRRTMVVILLVWLYSLAWSLAPLLGWSSYIPEGLMTSCTWDYVTSTPAN KGYTLMLCCFVFFIPLGIISYCYLCMFLAIRSAGREIERLGTQVRKSTLMQQQTIKTEWK LTKVAFVVIIVYVHSWSPYACVTLIAWAGYGSHLSPYSKAVPAVIAKASAIYNPFIYAII HSKYRDTLAEHVPCLYFLRQPPRKVSMSRAQSECSFRDSMVSRQSSASKTKFHRVSSTST ADTQVWSDVELDPMNHEGQSLRTSHSLGVLGRSKEHRGPPAQQNRQTRSSDTLEQATVAD WRPPLTALRCDRNFLPQPTHPPYKMAAATPLQATTVDNVTPEHWNKHPNNNHKNHNNRHN GNNNNEEHEYSGKGGRHCQNHPHHIDVKNSISNCKKTCEKDTFSKEPVPCNAADDVRFSP RSAHTIQHAMGTPFRYMPEGDIACQERLSTDRSQRGDPLPDSKSLNCTGDVPVSAQRCSF PHETSRNLEESFMAL
Uniprot No.

Target Background

Function
A photoreceptor involved in non-image-forming light responses.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the inner nuclear layer of the retina, possibly in amacrine and ganglion cells. Expressed in a subpopulation of neurons in the dorsal habenula.

Q&A

What is Recombinant Gadus morhua Melanopsin-B (opn4b)?

Recombinant Gadus morhua Melanopsin-B (opn4b) is a full-length (615 amino acids) photosensitive protein derived from Atlantic cod (Gadus morhua). It belongs to the opsin family of G protein-coupled receptors and functions as a photopigment involved in non-visual photoreception. The recombinant form (UniProt ID: Q804Q2) is typically expressed in E. coli with an N-terminal His tag to facilitate purification and detection in experimental settings. This protein plays a critical role in light-dependent signaling pathways similar to those found in intrinsically photosensitive retinal ganglion cells (ipRGCs) of vertebrates, where melanopsin mediates responses to light that regulate circadian rhythms, pupillary light reflex, and other non-image-forming functions .

What are the structural characteristics of Gadus morhua Melanopsin-B?

Gadus morhua Melanopsin-B consists of 615 amino acids with a sequence that shows greater homology to invertebrate rhodopsins than to typical vertebrate visual opsins . The full amino acid sequence of the recombinant protein is: MDMDRGFYRKVDVPDHAHYVIAFFVLIIGVVGVTGNALVMYAFLCNKKLRTPPNYFIMNLAVSDFLMAITQSPIFFINSLFKEWIFGETGCRMYAFCGALFGITSMINLLAISLDRYIVITKPPQAIRWVSGRRTMVVILLVWLYSLAWSLAPLLGWSSYIPEGLMTSCTWDYVTSTPANKGYTLMLCCFVFFIPLGIISYCYLCMFLAIRSAGREIERLGTQVRKSTLMQQQTIKTEWKLTKVAFVVIIVYVHSWSPYACVTLIAWAGYGSHLSPYSKAVPAVIAKASAIYNPFIYAIIHSKYRDTLAEHVPCLYFLRQPPRKVSMSRAQSECSFRDSMVSRQSSASKTKFHRVSSTSTADITQVWSDVELDPMNHEGQSLRTSHSLGVLGRSKEHRGPPAQQNRQTRSSDTLEQATVADWRPPLTALRCDRNFLPQPTHPPYKMAAATPLQATTVDNVTPEHWNKHPNNNHKNHNNRHNGNNNNEEHEYSGKGGRHCQNHPHHIDVKNSISNCKKTCEKDTFSKEPVPCNAADDVRFSPRSAHTIQHAMGTPFRYMPEGDIACQERLSTDRSQRGDPLPDSKSLNCTGDVPVSAQRCSFPHETSRNLEESFMAL .

Like other melanopsins, it contains the characteristic seven-transmembrane domain structure of G protein-coupled receptors and utilizes a retinaldehyde chromophore for photon detection. The N-terminal His tag in the recombinant version facilitates protein purification while maintaining functional properties.

How is Recombinant Gadus morhua Melanopsin-B produced and stored?

Recombinant Gadus morhua Melanopsin-B is typically produced through heterologous expression in E. coli bacterial systems. After expression, the protein is purified using affinity chromatography that targets the N-terminal His tag. The purified protein is then lyophilized into a powder form for long-term stability .

For storage, the following protocol is recommended:

  • Store the lyophilized protein at -20°C to -80°C upon receipt

  • Aliquot the reconstituted protein for multiple uses to avoid repeated freeze-thaw cycles

  • For working stocks, store aliquots at 4°C for up to one week

  • For reconstituted protein, storage in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 is optimal

  • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C

Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided to maintain functional integrity.

What is the evolutionary significance of Melanopsin-B in Atlantic cod?

Melanopsin-B in Atlantic cod represents an important evolutionary adaptation for non-visual photoreception in marine environments. Similar to melanopsins in other species, Gadus morhua Melanopsin-B likely plays critical roles in regulating circadian rhythms, light-dependent behaviors, and physiological responses to environmental light cues. Comparative analysis reveals that melanopsin shares greater sequence homology with invertebrate rhodopsins than with vertebrate visual opsins, suggesting an ancient evolutionary origin .

In vertebrates, melanopsin is expressed in intrinsically photosensitive retinal ganglion cells (ipRGCs) that project to brain regions involved in non-image forming visual functions, including the suprachiasmatic nucleus (SCN), ventral subparaventricular zone (vSPZ), ventrolateral preoptic area (VLPO), and pretectal area (PTA) . These projections mediate responses such as circadian entrainment, pupillary light reflex, and sleep-wake regulation. The preservation of melanopsin across diverse vertebrate species, including fish like the Atlantic cod, underscores its fundamental importance in light detection beyond classical image formation.

How should Recombinant Gadus morhua Melanopsin-B be reconstituted for experimental use?

Proper reconstitution of Recombinant Gadus morhua Melanopsin-B is critical for maintaining its functional properties. Follow these methodological steps for optimal reconstitution:

  • Briefly centrifuge the vial containing lyophilized protein to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as default)

  • Gently mix by inversion or slow pipetting rather than vortexing to avoid protein denaturation

  • Aliquot the reconstituted protein into small volumes suitable for single-use experiments

  • Store reconstituted aliquots according to the storage recommendations

For experiments requiring specific buffer conditions, perform buffer exchange using dialysis or desalting columns after initial reconstitution in the recommended buffer.

What methodologies can be used to study Melanopsin-B phototransduction pathways?

To investigate the phototransduction pathways mediated by Melanopsin-B, researchers can employ several methodological approaches:

  • Electrophysiological recordings: Patch-clamp techniques can be used to measure melanopsin-dependent photocurrents in cellular expression systems. This approach has revealed that melanopsin phototransduction involves a Gq/PLC-based cascade that ultimately leads to the opening of transient receptor potential (TRPC) channels . For example, whole-cell voltage-clamp recordings at -66 mV following brief, 50 ms full-field light flashes (480 nm, 15 photons · cm–2 · s–1) can be used to detect melanopsin-mediated inward currents .

  • Calcium imaging: Since melanopsin activation leads to calcium influx in many cell types, calcium-sensitive fluorescent dyes or genetically encoded calcium indicators can be used to monitor melanopsin-dependent signaling.

  • Pharmacological manipulation: Channel blockers such as ZD7288 (HCN channel blocker) and T-type calcium channel blockers can be used to dissect the contribution of different ion channels to the melanopsin-mediated response .

  • Heterologous expression systems: Recombinant Melanopsin-B can be expressed in cell lines (e.g., HEK293) to study its intrinsic properties and downstream signaling cascades in isolation from other photoreceptors.

  • In vitro reconstitution: Purified recombinant Melanopsin-B can be reconstituted into liposomes or nanodiscs with appropriate G proteins to study the initial steps of phototransduction in a controlled environment.

By combining these approaches, researchers can dissect the complex signaling pathways initiated by Melanopsin-B activation and compare them with melanopsins from other species.

How can researchers verify the functional activity of Recombinant Gadus morhua Melanopsin-B?

Verifying the functional activity of Recombinant Gadus morhua Melanopsin-B requires multiple complementary approaches:

  • Spectroscopic analysis: Absorption spectroscopy to confirm the presence of properly folded protein with bound chromophore. Active melanopsin should display characteristic absorbance peaks when bound to its retinal chromophore.

  • Light-induced conformational changes: Monitor conformational changes upon light exposure using techniques such as circular dichroism or fluorescence spectroscopy.

  • G protein activation assays: Measure the ability of light-activated melanopsin to catalyze nucleotide exchange on appropriate G proteins (typically Gq/11) using radioactive or fluorescent GTP analogs.

  • Downstream signaling assays: Monitor the activation of PLC and subsequent production of inositol phosphates and diacylglycerol, as melanopsin typically couples to Gq/11 and activates PLC-dependent pathways .

  • Calcium mobilization: Measure intracellular calcium changes in response to light in cells expressing recombinant melanopsin, as calcium mobilization is a major downstream effect of melanopsin activation.

  • Electrophysiological recordings: In cellular expression systems, patch-clamp recordings can detect light-induced currents mediated by melanopsin activation and subsequent opening of TRPC channels .

Each of these assays provides complementary information about different aspects of melanopsin function, from chromophore binding to downstream signaling events.

What experimental models are suitable for studying Recombinant Gadus morhua Melanopsin-B?

Several experimental models are suitable for studying Recombinant Gadus morhua Melanopsin-B, each with distinct advantages:

  • Heterologous expression systems: Cell lines like HEK293, CHO, or Neuro-2a can be transfected with Melanopsin-B constructs to study basic properties and signaling mechanisms. These systems allow for controlled expression and manipulation of the protein in isolation from other photoreceptors.

  • Primary retinal cultures: Dissociated retinal cells or retinal explants from model organisms can be used to study melanopsin function in a more physiologically relevant context. These can be combined with viral vectors expressing Gadus morhua Melanopsin-B to study its function.

  • Transgenic animals: While challenging, transgenic expression of Gadus morhua Melanopsin-B in model organisms like mice (particularly in melanopsin-knockout backgrounds) can provide insights into its function in vivo.

  • Reconstituted in vitro systems: Purified recombinant protein can be reconstituted into artificial membrane systems (liposomes, nanodiscs) along with relevant signaling components to study molecular mechanisms in a defined environment.

  • Ex vivo retina preparations: Retinal tissue from model organisms can be used for electrophysiological recordings or calcium imaging after viral transduction with Gadus morhua Melanopsin-B constructs.

Selection of the appropriate model depends on the specific research question, with each system offering different balances of physiological relevance versus experimental control.

What phototransduction pathways are activated by Gadus morhua Melanopsin-B?

While the specific phototransduction pathways activated by Gadus morhua Melanopsin-B are not explicitly detailed in the provided search results, we can infer likely mechanisms based on research on melanopsins in other species:

Melanopsin typically initiates a signaling cascade similar to that of invertebrate rhodopsins, involving:

  • G protein activation: Light activation of melanopsin leads to conformational changes that activate Gq/11 type G proteins.

  • Phospholipase C (PLC) activation: Activated G proteins stimulate PLC, which hydrolyzes phosphatidylinositol 4,5-bisphosphate (PIP2) to produce inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG).

  • Channel regulation: The signaling cascade ultimately leads to the opening of TRPC channels (particularly TRPC6/7), resulting in membrane depolarization and calcium influx .

Research on mammalian ipRGCs has revealed diversity in phototransduction mechanisms across cell subtypes. For example, in M4 ipRGCs, melanopsin phototransduction involves potassium channel closure and TRPC channel opening, while in M2 ipRGCs, it requires TRPC channels in conjunction with T-type voltage-gated calcium channels .

Given these findings, Gadus morhua Melanopsin-B likely activates similar pathways, potentially with species-specific adaptations related to its marine environment. Further research specifically on Gadus morhua Melanopsin-B would be needed to determine the precise components and regulation of its phototransduction cascade.

How can Recombinant Gadus morhua Melanopsin-B be used in comparative photobiology studies?

Recombinant Gadus morhua Melanopsin-B offers valuable opportunities for comparative photobiology studies:

  • Evolutionary conservation of phototransduction: By comparing the signaling properties of Gadus morhua Melanopsin-B with melanopsins from other vertebrates and invertebrates, researchers can investigate the evolutionary conservation and divergence of phototransduction mechanisms. This could involve heterologous expression of different melanopsins in the same cellular background to directly compare their spectral sensitivities, signaling kinetics, and downstream pathway activation.

  • Adaptation to aquatic environments: Atlantic cod inhabit marine environments with distinct light conditions compared to terrestrial or freshwater habitats. Studies comparing Gadus morhua Melanopsin-B with melanopsins from terrestrial vertebrates could reveal adaptations to marine photoenvironments, such as differences in spectral tuning or sensitivity.

  • Functional substitution experiments: Expressing Gadus morhua Melanopsin-B in melanopsin-deficient cells or organisms from other species could reveal the degree of functional conservation across species. For example, expressing it in melanopsin-knockout mouse ipRGCs could determine whether it can rescue non-image forming visual functions.

  • Structure-function relationships: Comparing the amino acid sequences and structural features of melanopsins across species, including Gadus morhua Melanopsin-B, can identify conserved domains critical for photoreception and signaling, as well as variable regions that might confer species-specific properties.

  • Ecological correlations: Correlating the molecular properties of Gadus morhua Melanopsin-B with the ecological niche and visual behaviors of Atlantic cod could provide insights into the adaptive significance of specific melanopsin features.

These comparative approaches can significantly advance our understanding of melanopsin evolution and adaptation across vertebrate lineages.

What are the challenges in studying melanopsin-dependent signaling using recombinant proteins?

Studying melanopsin-dependent signaling using recombinant proteins presents several methodological challenges:

  • Proper protein folding and chromophore binding: Ensuring that recombinant melanopsin folds correctly and efficiently binds its retinal chromophore in heterologous expression systems can be challenging. The efficiency of chromophore binding significantly affects photosensitivity and signaling properties.

  • Membrane insertion and topology: As a seven-transmembrane protein, melanopsin must be correctly inserted into membranes with the proper topology. Achieving this in heterologous systems or with purified protein in artificial membranes requires careful optimization.

  • Reconstitution of native signaling complexes: In vivo, melanopsin likely functions within macromolecular signaling complexes. Recombinant systems may lack important accessory proteins, scaffold molecules, or other components that modulate signaling in the native context.

  • Light-dependent protein stability: Photopigments can undergo conformational changes and potential degradation upon repeated light exposure. Maintaining protein stability during experimental manipulations, especially those involving light stimulation, requires careful consideration.

  • Signaling differences across experimental systems: Research has shown that melanopsin phototransduction pathways differ among cell types (e.g., M1 vs. non-M1 ipRGCs) . Results obtained in one experimental system may not fully generalize to other cellular contexts or to the native environment.

  • Mimicking physiological light conditions: Creating light stimulation protocols that accurately mimic the relevant physiological conditions (intensity, duration, wavelength) that the protein would experience in vivo can be technically challenging.

Addressing these challenges requires careful experimental design, appropriate controls, and often the integration of multiple complementary approaches to validate findings.

What are common challenges in experiments using Recombinant Gadus morhua Melanopsin-B?

Researchers working with Recombinant Gadus morhua Melanopsin-B may encounter several common challenges:

  • Protein stability issues: Melanopsins can be unstable after reconstitution. Monitoring protein stability through regular quality control checks is essential. The recommended storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0 and addition of 5-50% glycerol for long-term storage helps mitigate stability issues .

  • Variability in functional activity: Batch-to-batch variations in protein activity can occur. Establishing consistent activity assays and including reference standards in each experiment is crucial.

  • Light exposure during handling: Inadvertent light exposure during protein handling can activate the photopigment, potentially leading to desensitization or altered activity. Work under dim red light conditions when practical.

  • Chromophore association: Ensuring efficient binding of the retinal chromophore to recombinant melanopsin can be challenging. Pre-incubation with retinal under optimized conditions may be necessary to achieve maximal photosensitivity.

  • Background signaling in heterologous systems: Cell lines used for melanopsin expression may have endogenous photosensitivity or signaling components that interfere with melanopsin-specific responses. Appropriate negative controls and pharmacological tools are necessary to isolate melanopsin-dependent signals.

  • Reproducibility of light stimulation: Consistent light stimulation parameters (intensity, duration, wavelength) are critical for reproducible results. Calibration of light sources before each experiment is recommended.

To address these challenges, researchers should implement rigorous quality control procedures, include appropriate controls in each experiment, and carefully document all experimental conditions.

How can researchers address inconsistent results in melanopsin activation studies?

When faced with inconsistent results in melanopsin activation studies, researchers should systematically address potential sources of variability:

  • Protein quality assessment: Verify protein quality before each experiment using techniques such as SDS-PAGE, Western blotting, and spectroscopic analysis to ensure consistency in protein concentration, purity, and integrity.

  • Standardized reconstitution protocols: Follow strict reconstitution protocols as recommended (deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol) , and document any deviations that might affect results.

  • Controlled light conditions: Calibrate light sources before each experiment to ensure consistent intensity and spectral properties. Document the exact parameters used (wavelength, intensity, duration) and maintain consistent ambient lighting conditions.

  • Cell culture conditions: For cellular assays, standardize cell culture conditions including passage number, confluence, expression levels, and time post-transfection, all of which can affect melanopsin expression and signaling.

  • Pharmacological tools: Use selective pharmacological tools to dissect signaling pathways. For example, TRPC channel blockers can help distinguish melanopsin-specific signals from other pathways, as TRPC channels are important components of melanopsin signaling in many cell types .

  • Internal controls: Include positive and negative controls in each experiment to normalize for day-to-day variations in experimental conditions.

  • Environmental variables: Control temperature, pH, and ionic composition of solutions, as these factors can significantly affect protein function and signaling pathways.

  • Statistical approaches: Apply appropriate statistical methods to distinguish experimental noise from true biological variability, and consider increasing sample sizes when variability is high.

Documenting all experimental procedures in detail and maintaining consistent protocols across experiments are essential for identifying and addressing sources of inconsistency.

What controls should be used in experiments with Recombinant Gadus morhua Melanopsin-B?

Rigorous experimental design with Recombinant Gadus morhua Melanopsin-B requires appropriate controls:

  • Inactive protein controls: Use heat-denatured or light-bleached melanopsin samples as negative controls to distinguish specific melanopsin-dependent effects from non-specific protein effects.

  • Empty vector controls: In expression studies, include cells transfected with empty vectors to control for effects of the transfection process or vector components.

  • Dark controls: Maintain parallel samples in complete darkness throughout the experiment to establish baseline activity in the absence of light stimulation.

  • Wavelength controls: Use light stimuli outside the sensitivity range of melanopsin to control for non-specific effects of light exposure.

  • Pharmacological controls: Include specific inhibitors of the melanopsin signaling pathway (e.g., PLC inhibitors, TRPC channel blockers) to confirm that observed effects are mediated through expected signaling mechanisms .

  • Chromophore controls: In reconstitution experiments, include samples without added chromophore to establish the dependency of observed effects on chromophore binding.

  • Species specificity controls: When possible, compare results with melanopsins from other species to distinguish species-specific effects from conserved mechanisms.

  • System suitability controls: Include positive controls for each assay (e.g., directly activating downstream signaling components) to verify that the experimental system is functioning as expected.

These controls help ensure that observed effects are specifically attributable to Recombinant Gadus morhua Melanopsin-B activity and not to experimental artifacts or non-specific effects.

How should researchers interpret contradictory data in melanopsin signaling studies?

When confronted with contradictory data in melanopsin signaling studies, researchers should consider several factors:

  • Methodological differences: Different experimental approaches can yield apparently contradictory results. For example, research on melanopsin phototransduction has shown discrepancies between studies using different methods to assess ion channel involvement. In M4 ipRGCs, contradictory models of phototransduction were resolved by demonstrating that hyperpolarization-activated cyclic nucleotide-gated (HCN) channels are dispensable for the process, while TRPC channels are essential .

  • Cellular context variations: Melanopsin signaling pathways can differ substantially between cell types. Research has shown that different subtypes of ipRGCs (M1-M6) employ diverse phototransduction cascades . When comparing studies, consider whether differences in cellular context might explain contradictory findings.

  • Protein modifications: Post-translational modifications, alternative splicing, or truncations of melanopsin can alter its signaling properties. Verify that the same protein form is being studied across compared experiments.

  • Light stimulus parameters: Differences in light intensity, duration, or wavelength can activate different signaling pathways or components. Pay careful attention to the precise light stimulation protocols used in each study.

  • Species differences: Melanopsins from different species may have evolved distinct signaling mechanisms. Contradictory findings might reflect true biological differences rather than experimental errors.

  • Temporal considerations: Some signaling events occur transiently or with different kinetics across experimental systems. Time-course studies may help reconcile apparently contradictory snapshot observations.

  • Concentration-dependent effects: Protein concentration can affect aggregation state, interaction with signaling partners, and functional outcomes. Comparing results across a range of concentrations may help resolve contradictions.

When interpreting contradictory data, consider designing experiments that directly test competing hypotheses under identical conditions, as was done to resolve contradictory models of M4 ipRGC phototransduction .

What are the emerging applications for Recombinant Gadus morhua Melanopsin-B in research?

Recombinant Gadus morhua Melanopsin-B offers exciting opportunities for innovative research applications:

  • Comparative phototransduction studies: The unique evolutionary position of fish melanopsins makes them valuable for comparative studies of phototransduction mechanisms across vertebrate lineages. Studies comparing Gadus morhua Melanopsin-B with melanopsins from other species could reveal evolutionary adaptations in photoreception mechanisms.

  • Optogenetic tools development: The properties of fish melanopsins, potentially including Gadus morhua Melanopsin-B, might be harnessed to develop novel optogenetic tools with distinct spectral sensitivities or signaling properties compared to existing tools.

  • Environmental adaptation research: Atlantic cod inhabit varying light environments throughout their life cycle. Studying Melanopsin-B could provide insights into how photoreception adapts to different marine light conditions and how this affects behavior and physiology.

  • Circadian biology: Melanopsin plays crucial roles in circadian photoentrainment across species . Gadus morhua Melanopsin-B could be used to investigate circadian mechanisms in marine organisms and their evolutionary relationship to terrestrial circadian systems.

  • Biosensor development: The photosensitive properties of melanopsin could potentially be leveraged to develop biosensors for monitoring environmental light conditions or for use in biomedical applications.

  • Structural biology: High-resolution structural studies of Gadus morhua Melanopsin-B could reveal unique features that contribute to its function and provide templates for structure-based design of melanopsin-targeted compounds.

These emerging applications highlight the diverse research potential of Recombinant Gadus morhua Melanopsin-B beyond its primary role in photoreception.

How might comparative studies of melanopsins advance our understanding of photoreception?

Comparative studies of melanopsins, including Gadus morhua Melanopsin-B, can significantly advance photoreception research:

  • Evolutionary insights: By comparing melanopsins across diverse species from fish to mammals, researchers can reconstruct the evolutionary history of photoreception and identify conserved mechanisms that have been maintained over millions of years of evolution.

  • Adaptation to ecological niches: Different species inhabit environments with distinct light conditions. Comparative studies can reveal how melanopsin properties (spectral sensitivity, signaling kinetics, expression patterns) have adapted to these diverse photoenvironments.

  • Functional diversification: In mammals, melanopsin signaling in different ipRGC subtypes (M1-M6) involves diverse phototransduction cascades tailored to specific functions . Comparing these with melanopsins from other vertebrates can reveal how functional diversification has occurred during evolution.

  • Structural determinants of function: Comparative sequence analysis, coupled with structural studies, can identify critical residues and domains that determine specific functional properties, providing targets for experimental manipulation.

  • Convergent evolution: Comparing melanopsins with other photopigments (e.g., invertebrate rhodopsins, vertebrate visual opsins) can reveal instances of convergent evolution and shed light on fundamental constraints in photoreceptor design.

  • Translational insights: Understanding the diversity of photoreception mechanisms across species can inspire biomimetic technologies and potential therapeutic approaches for human disorders of light detection and circadian rhythm regulation.

By embracing comparative approaches, researchers can move beyond species-specific descriptions to develop more general principles of photoreceptor function and evolution.

What technological advancements could enhance research on melanopsin function?

Several technological advancements could significantly advance melanopsin research:

  • Cryo-electron microscopy (cryo-EM): High-resolution structural determination of melanopsin in different conformational states (dark, light-activated, signaling) would provide unprecedented insights into its activation mechanism and interactions with signaling partners.

  • Advanced optogenetic approaches: Development of spectrally shifted melanopsin variants or melanopsin-based optogenetic tools with tailored kinetics would enable more precise manipulation of melanopsin signaling in vivo.

  • Single-molecule techniques: Methods such as single-molecule fluorescence resonance energy transfer (smFRET) could reveal the conformational dynamics of melanopsin during photoactivation and signaling.

  • Nanobody development: Melanopsin-specific nanobodies could serve as powerful tools for detecting, purifying, and manipulating melanopsin in various experimental contexts.

  • Advanced electrophysiological approaches: Techniques combining optogenetics, calcium imaging, and electrophysiology could provide more detailed characterization of melanopsin-dependent electrical responses in different cell types, building on existing methodologies used to study ipRGC subtypes .

  • Computational modeling: Advanced molecular dynamics simulations and machine learning approaches could predict melanopsin structural changes during photoactivation and interaction with signaling partners.

  • Multiplexed gene editing: CRISPR-based approaches for simultaneously modifying multiple components of melanopsin signaling pathways could help dissect complex signaling networks.

These technological advancements would complement existing approaches and could resolve current controversies in melanopsin research, such as those regarding the precise ion channels involved in phototransduction in different cell types .

What are the broader implications of melanopsin research for understanding visual and non-visual photoreception?

Research on melanopsins, including Gadus morhua Melanopsin-B, has far-reaching implications for understanding photoreception:

  • Expanded conception of photoreception: Melanopsin research has fundamentally changed our understanding of photoreception by demonstrating the existence of photosensitive systems outside classical rod and cone photoreceptors, operating through distinct molecular mechanisms .

  • Integration of visual and non-visual pathways: Studies have revealed complex interactions between classical visual pathways and melanopsin-dependent non-visual pathways. In mammals, melanopsin-expressing ipRGCs contribute to both image-forming and non-image-forming vision through diverse projections to brain regions such as the SCN, vSPZ, VLPO, and PTA .

  • Circadian health implications: Understanding melanopsin signaling has important implications for human health, particularly regarding the effects of artificial lighting on circadian rhythms, sleep, and related disorders.

  • Evolutionary perspective on photoreception: The greater sequence homology of melanopsin to invertebrate rhodopsins than to vertebrate visual opsins suggests an ancient evolutionary origin and provides insights into the evolutionary history of photoreception .

  • Diverse signaling mechanisms: Research on melanopsin in different ipRGC subtypes has revealed remarkable diversity in phototransduction mechanisms, with different subtypes employing distinct combinations of ion channels and signaling components . This diversity highlights the adaptability of photoreceptive systems.

  • Therapeutic targeting: Detailed understanding of melanopsin signaling opens possibilities for therapeutic interventions in disorders related to light detection, circadian rhythm disruption, and sleep dysfunction.

By continuing to investigate melanopsins across species, including Gadus morhua Melanopsin-B, researchers can develop a more comprehensive understanding of the complex and multifaceted nature of photoreception in vertebrates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.