Recombinant Gadus morhua NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

What is the functional role of MT-ND3 in the respiratory chain Complex I?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) functions as one of the core subunits of respiratory Complex I. This mitochondrially-encoded protein contributes to the structural integrity of the membrane domain (MD) of Complex I and participates in the coupling mechanism between electron transfer and proton translocation.

The MT-ND3 subunit specifically:

• Forms part of the proton-pumping module (P-module) in the membrane domain

• Contributes to the conformational changes that occur during catalysis

• Participates in maintaining the proper architecture of the ubiquinone binding site

• Supports the vectorial proton transfer essential for energy conservation in the form of proton motive force (pmf)

In Gadus morhua (Atlantic cod), the MT-ND3 protein consists of 116 amino acids with a characteristic hydrophobic profile suitable for membrane integration .

How is recombinant Gadus morhua MT-ND3 typically produced for research applications?

Recombinant production of Gadus morhua MT-ND3 generally follows these methodological approaches:

• Expression system selection: Due to its hydrophobic nature and mitochondrial origin, MT-ND3 expression typically requires specialized systems. Bacterial expression systems (modified E. coli strains) with optimized codons for membranous proteins are commonly employed.

• Vector design considerations:

  • Incorporation of appropriate tags (His, GST, or others) to facilitate purification

  • Use of strong inducible promoters to control expression

  • Inclusion of membrane-targeting sequences to improve folding

• Expression conditions optimization:

  • Induction at lower temperatures (16-18°C) to improve folding

  • Addition of specific detergents during cell lysis to solubilize the membrane protein

  • Use of specialized media formulations to enhance expression

• Purification strategy:

  • Affinity chromatography using the fusion tag

  • Size exclusion chromatography to remove aggregates

  • Quality control via SDS-PAGE and western blotting

The recombinant protein is typically stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage to maintain stability .

What are the key structural features of Gadus morhua MT-ND3 relevant to its function?

The structural characteristics of Gadus morhua MT-ND3 that contribute to its functionality include:

• Transmembrane domains: The 116-amino acid sequence contains multiple hydrophobic segments that form transmembrane helices, enabling its integration into the inner mitochondrial membrane.

• Amino acid sequence: The primary structure (MNLISTVILIASALSLILILVSFWLPQLSPDYEKLSPYECGFDPLGSARLPFSLRFFLIAILFLLFDLEIALLLPLPWGDQLSNPTLTFMWATSVLALLTLGLIYEWLQGGLEWAE) features conserved residues that are critical for protein-protein interactions within Complex I .

• Functional motifs: Contains conserved regions that participate in:

  • Subunit interactions within Complex I

  • Conformational changes during catalysis

  • Potential proton translocation pathways

• Conservation across species: Comparative analysis reveals high conservation of certain residues across species, indicating their importance in the fundamental functioning of Complex I.

How do mutations in MT-ND3 affect Complex I activity and what methodologies are used to assess these effects?

Mutations in MT-ND3 can significantly impact Complex I functionality through several mechanisms:

• Disruption of electron transfer: Mutations may alter the spatial arrangement of redox centers, affecting electron flow from NADH to ubiquinone. This can be assessed through:

  • Spectrophotometric measurement of NADH oxidation rates

  • Electron paramagnetic resonance (EPR) analysis of iron-sulfur cluster reduction states

  • Ubiquinone reduction kinetics analysis

• Impairment of proton translocation: Mutations can compromise the proton pumping efficiency, which can be evaluated by:

  • Measurement of proton motive force using pH-sensitive fluorescent probes

  • Membrane potential analysis with potentiometric dyes

  • Direct measurement of H+/e- stoichiometry

• Structural destabilization: Certain mutations may affect the assembly or stability of Complex I, assessable through:

  • Blue native PAGE analysis of intact complex

  • Pulse-chase experiments to measure complex half-life

  • Immunoprecipitation studies to examine subunit interactions

• ATP production impairment: The ultimate functional consequence can be measured by:

  • Oxygen consumption rate (OCR) measurements

  • ATP production assays with different substrates

  • Assessment of NAD+/NADH ratios

The impact of mutations can be quantified by comparing the activities of wild-type and mutant enzymes. For instance, the novel m.10372A>G mutation in MT-ND3 reported in a patient with sensorimotor axonal polyneuropathy showed:

• Significant reduction in Complex I respiratory chain activity

• Decreased ATP production with all substrates utilized by Complex I

• Morphological abnormalities including ragged red fibers and paracrystalline inclusions in muscle tissue

What experimental approaches are optimal for investigating protein-protein interactions involving MT-ND3 within Complex I?

Investigating protein-protein interactions involving MT-ND3 within the larger Complex I structure requires specialized approaches:

• Crosslinking mass spectrometry (XL-MS):

  • Chemical crosslinkers of varying lengths can be used to capture direct interactions

  • MS/MS analysis identifies crosslinked peptides

  • Provides distance constraints between interacting residues

  • Data can be integrated with structural models to refine interaction interfaces

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Maps solvent accessibility and dynamics of protein regions

  • Identifies protected regions that may represent interaction interfaces

  • Temporal resolution allows examination of dynamic interactions during catalysis

• Site-directed mutagenesis coupled with functional assays:

  • Systematic mutation of conserved residues followed by assembly and activity assays

  • Identification of residues critical for interaction with other subunits

  • Complementation studies in model systems

• Cryo-electron microscopy:

  • High-resolution structural analysis of intact Complex I

  • Visualization of MT-ND3 in context of the complete structure

  • Identification of conformational changes in different functional states

• Co-immunoprecipitation with targeted antibodies:

  • Pull-down of MT-ND3 and analysis of associated proteins

  • Identification of stable interaction partners

  • Can be combined with crosslinking for transient interactions

These methodologies should be applied in complementary fashion, as each provides different but valuable insights into the interaction landscape of MT-ND3 within Complex I.

How can heteroplasmy levels of MT-ND3 mutations be accurately quantified in different tissue samples?

Accurate quantification of heteroplasmy levels (the proportion of mutant to wild-type mtDNA) is critical for understanding mutation pathogenicity and tissue-specific effects. The following methodological approaches can be employed:

• Last-cycle hot PCR:

  • Incorporation of radiolabeled nucleotides in the final PCR cycle

  • Restriction enzyme digestion to distinguish mutant and wild-type fragments

  • Quantification via phosphorimager analysis

  • Provides high sensitivity for heteroplasmy detection

• Pyrosequencing:

  • Sequencing-by-synthesis approach

  • Quantitative measurement of nucleotide incorporation

  • Linear relationship between signal intensity and heteroplasmy level

  • Detection limit approximately 5-10%

• Digital droplet PCR (ddPCR):

  • Partitioning of DNA into thousands of droplets

  • Absolute quantification of mutant and wild-type molecules

  • High precision at low heteroplasmy levels (down to 0.1%)

  • Less susceptible to PCR inhibitors than other methods

• Next-generation sequencing (NGS):

  • Ultra-deep sequencing of mtDNA

  • Bioinformatic analysis of variant frequencies

  • Simultaneous analysis of multiple mtDNA variants

  • Requires careful control for sequencing errors

• Single-cell analysis:

  • Isolation of individual cells followed by mtDNA analysis

  • Reveals cell-to-cell heteroplasmy variation

  • Important for understanding threshold effects

  • Can employ FACS sorting with mitochondrial membrane potential dyes

For comprehensive assessment, tissue-specific heteroplasmy analysis should be performed, as demonstrated in the case study where MT-ND3 mutation was detected in skeletal muscle but absent in cultured myoblasts from the same patient . This finding highlights the importance of appropriate tissue selection for diagnostic testing.

How can recombinant Gadus morhua MT-ND3 be utilized as a model system for studying human mitochondrial disorders?

Recombinant Gadus morhua MT-ND3 offers valuable research applications for studying human mitochondrial disorders:

• Comparative structural biology:

  • Despite evolutionary distance, key functional domains in MT-ND3 show remarkable conservation

  • Fish models provide insights into fundamental aspects of Complex I function

  • Structural differences can highlight functionally critical conserved regions

• Mutation modeling:

  • Equivalent mutations to human pathogenic variants can be introduced

  • Effects on assembly, stability, and function can be assessed in a simplified system

  • Results can inform understanding of human disease mechanisms

• Drug screening platform:

  • Recombinant protein can be used to screen compounds that restore function of mutant proteins

  • Identification of molecules that stabilize Complex I assembly

  • Development of species-specific modulators of Complex I activity

• Heterologous expression systems:

  • Different cellular backgrounds allow assessment of environmental factors affecting MT-ND3 function

  • Study of interspecies compatibility in chimeric Complex I assemblies

  • Insights into evolution of mitochondrial-nuclear genetic compatibility

The study of MT-ND3 from Gadus morhua can illuminate fundamental aspects of Complex I biology relevant to human disease, particularly for conditions like sensorimotor axonal polyneuropathy associated with MT-ND3 mutations .

What are the most effective experimental approaches for investigating the role of MT-ND3 in reactive oxygen species (ROS) production?

Investigation of MT-ND3's role in ROS production requires sophisticated methodological approaches:

• Site-specific ROS detection:

  • MitoSOX Red for mitochondrial superoxide quantification

  • Dihydroethidium (DHE) for cellular superoxide measurement

  • H2DCFDA for general ROS detection

  • Combination with confocal microscopy for subcellular localization

• Modulation of MT-ND3 expression or mutation:

  • Knockdown/knockout approaches in cellular models

  • Introduction of specific mutations associated with altered ROS production

  • Correlation of MT-ND3 variants with ROS levels

• Biochemical analysis of isolated Complex I:

  • Measurement of superoxide production using electron spin resonance (ESR)

  • Amplex Red assays for hydrogen peroxide quantification

  • Assessment of ROS production under forward and reverse electron transport conditions

• Investigation of ROS-sensitivity to inhibitors:

  • Effect of rotenone (inhibits at the ubiquinone binding site)

  • Impact of NAD+ and NADH concentrations on ROS production

  • Testing of nucleotide derivatives like ADP-ribose and NADH-OH

• Structural analysis focused on ROS-generating sites:

  • Identification of amino acids near FMN that influence oxygen accessibility

  • Examination of conformational changes that may expose/protect ROS-generating sites

  • Mutation of key residues (e.g., equivalent to E95Q in E. coli) that limit ROS production

What experimental design considerations are critical when investigating the impact of environmental stressors on MT-ND3 function?

When designing experiments to assess environmental stressor effects on MT-ND3 function, researchers should consider:

• Physiologically relevant stressor selection:

  • Temperature variations appropriate to the poikilothermic nature of Gadus morhua

  • Hypoxia conditions mimicking natural habitat fluctuations

  • pH changes reflecting ocean acidification scenarios

  • Pollutants encountered in native environments

• Acute versus chronic exposure paradigms:

  • Short-term exposures to assess immediate functional responses

  • Long-term treatments to evaluate adaptive responses

  • Recovery protocols to determine reversibility of effects

• Multi-level analytical approach:

  • Transcriptional analysis of MT-ND3 and interacting genes

  • Protein expression and stability assessment

  • Functional measurements of Complex I activity

  • Whole-organism physiological parameters

• Control considerations:

  • Appropriate vehicle controls for chemical stressors

  • Sham exposure controls for physical stressors

  • Multiple tissue sampling to assess tissue-specific responses

  • Time-matched controls for temporal effects

• Methodological validation:

  • Confirmation that assay conditions themselves don't influence MT-ND3 function

  • Verification that detection methods work properly under stressor conditions

  • Calibration of instruments for the specific experimental conditions

• Data integration strategy:

  • Correlation analyses between molecular and functional endpoints

  • Multivariate approaches to identify stressor-specific response patterns

  • Computational modeling to predict threshold effects

By carefully controlling these experimental design elements, researchers can generate reliable data on how environmental factors influence this critical component of energy metabolism in Gadus morhua, with potential implications for both evolutionary biology and environmental toxicology.

What are the recommended protocols for functional characterization of recombinant Gadus morhua MT-ND3?

Comprehensive functional characterization of recombinant Gadus morhua MT-ND3 requires multiple complementary approaches:

• Integration into membrane systems:

  • Reconstitution into proteoliposomes with other Complex I subunits

  • Incorporation into nanodiscs with appropriate lipid composition

  • Expression in mitochondria-depleted cell lines (ρ0 cells)

• Spectroscopic analysis:

  • UV-visible spectroscopy to monitor redox changes

  • Circular dichroism (CD) for secondary structure analysis

  • Fluorescence spectroscopy to assess conformational changes

  • FTIR for protein-lipid interactions

• Activity measurements:

  • NADH:ubiquinone oxidoreductase activity assays

  • Electron transfer rates to artificial acceptors

  • Proton pumping efficiency measurements

  • ROS production quantification

• Thermal and chemical stability assessment:

  • Differential scanning calorimetry (DSC)

  • Protease susceptibility assays

  • Detergent resistance measurements

  • Long-term stability at different temperatures

• Interaction analysis:

  • Surface plasmon resonance (SPR) with potential binding partners

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Förster resonance energy transfer (FRET) for proximity relationships

  • Pull-down assays for interaction network mapping

A standardized protocol should include controls such as known inhibitors (rotenone, piericidin A) and activators, as well as comparison with native Complex I isolated from Gadus morhua mitochondria to validate the recombinant protein's functional properties.

How can researchers effectively troubleshoot experimental challenges when working with MT-ND3?

Working with hydrophobic membrane proteins like MT-ND3 presents unique challenges that require systematic troubleshooting approaches:

• Expression yield optimization:

  • Issue: Low protein expression

  • Troubleshooting: Test multiple expression systems (bacterial, yeast, insect, mammalian)

  • Solution: Optimize codon usage, reduce toxicity with tightly controlled induction, use fusion partners to enhance solubility

• Protein aggregation management:

  • Issue: Formation of inclusion bodies or aggregates

  • Troubleshooting: Analyze detergent screening results, optimize buffer conditions

  • Solution: Express at lower temperatures, use specialized detergents (DDM, LMNG), add stabilizing agents (glycerol, specific lipids)

• Functional assay inconsistency:

  • Issue: Variable activity measurements

  • Troubleshooting: Systematic evaluation of assay components

  • Solution: Standardize protein:lipid ratios, control oxygen exposure, ensure consistent substrate quality

• Heteroplasmy quantification challenges:

  • Issue: Inconsistent heteroplasmy measurements

  • Troubleshooting: Compare results from multiple methods

  • Solution: Implement internal controls, use digital PCR for absolute quantification, perform technical replicates

• Protein-protein interaction detection limitations:

  • Issue: Weak or transient interactions

  • Troubleshooting: Modify crosslinking conditions, adjust buffer stringency

  • Solution: Use membrane-compatible crosslinkers, preserve native lipid environment, employ proximity labeling approaches

• Data interpretation complexities:

  • Issue: Distinguishing direct MT-ND3 effects from secondary consequences

  • Troubleshooting: Design appropriate control experiments

  • Solution: Use multiple complementary techniques, implement time-course studies, develop specific antibodies or detection methods

Each troubleshooting approach should be methodically documented to build an institutional knowledge base that benefits future researchers working with this challenging protein.

What emerging technologies show promise for advancing our understanding of MT-ND3 structure-function relationships?

Several cutting-edge technologies are poised to significantly enhance our understanding of MT-ND3 structure-function relationships:

• Cryo-electron tomography (cryo-ET):

  • Visualization of Complex I in situ within mitochondrial membranes

  • Capturing conformational states during catalysis

  • Revealing species-specific structural features of Gadus morhua MT-ND3

• Single-molecule FRET:

  • Real-time observation of conformational changes

  • Correlation of structural dynamics with catalytic events

  • Detection of rarely populated intermediate states

• AlphaFold2 and related AI structure prediction:

  • Accurate modeling of membrane protein structures

  • Prediction of interaction interfaces

  • Generation of testable hypotheses about mutation effects

• Time-resolved X-ray free-electron laser (XFEL) crystallography:

  • Capturing transient catalytic intermediates

  • Mapping electron and proton transfer pathways

  • Nanosecond-scale structural dynamics

• CRISPR-based mitochondrial DNA editing:

  • Precise introduction of MT-ND3 mutations

  • Creation of heteroplasmic model systems

  • Tissue-specific mutation expression

• Nanopore-based single-molecule protein analysis:

  • Label-free detection of conformational states

  • Direct measurement of protein-ligand interactions

  • High-throughput screening of conditions affecting stability

• Multi-modal correlative microscopy:

  • Integration of functional and structural data at multiple scales

  • Connecting molecular events to cellular consequences

  • Tissue-specific analysis of MT-ND3 variants

These emerging technologies will help address fundamental questions about how MT-ND3's structure contributes to Complex I assembly, stability, and the coupling mechanism between electron transfer and proton translocation.

How might comparative analysis of MT-ND3 across species contribute to understanding evolutionary aspects of mitochondrial function?

Comparative analysis of MT-ND3 across species offers valuable insights into the evolution of mitochondrial function:

• Adaptation to environmental niches:

  • Comparison of MT-ND3 sequences from fish adapted to different thermal environments

  • Analysis of amino acid substitutions in species with varying metabolic rates

  • Correlation of MT-ND3 variants with environmental parameters

• Co-evolution with nuclear-encoded subunits:

  • Identification of compensatory mutations between mitochondrial and nuclear genes

  • Mapping of species-specific interaction networks

  • Understanding constraints on mitochondrial-nuclear compatibility

• Functional constraint mapping:

  • Identification of invariant residues across diverse lineages

  • Correlation of evolutionary conservation with structural elements

  • Detection of positively selected sites indicating adaptive evolution

• Pathogenic mutation interpretation:

  • Evaluation of disease-associated human mutations in evolutionarily diverse contexts

  • Prediction of mutation effects based on evolutionary tolerance

  • Identification of naturally occurring compensatory mechanisms

• Methodological approaches:

  • Phylogenetic analysis with selection pressure assessment (dN/dS ratios)

  • Ancestral sequence reconstruction and functional testing

  • Comparative biochemistry of purified Complex I from diverse species

  • Cross-species complementation studies

Comparative studies can reveal how fundamental aspects of Complex I function have been preserved while allowing adaptation to diverse environments, providing insights into both basic bioenergetic principles and potential therapeutic approaches for mitochondrial disorders.