Recombinant Gadus morhua NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Gadus morhua MT-ND4L is a 10.7 kDa transmembrane protein encoded by the mitochondrial genome. It consists of 98 amino acids and forms part of the NADH-ubiquinone oxidoreductase (Complex I), the first enzyme in the electron transport chain .

Mechanism of Action

  1. Electron Transfer: NADH donates electrons to FMN, which pass through iron-sulfur clusters to ubiquinone, reducing it to ubiquinol .

  2. Proton Pumping: Conformational changes during electron transport drive proton translocation across the mitochondrial membrane, contributing to ATP synthesis .

Expression Systems

  • Host: Typically expressed in Escherichia coli or yeast systems for cost-effective scalability .

  • Purification: Affinity chromatography (e.g., His-tag) followed by SDS-PAGE validation (>85% purity) .

Experimental Uses

  • Mitochondrial Dysfunction Studies: Used to investigate mutations linked to Leber’s hereditary optic neuropathy (LHON) and metabolic disorders .

  • Complex I Activity Assays: Measures electron transport efficiency in vitro .

  • Antibody Development: Serves as an antigen for generating antibodies targeting ND4L .

Case Study: LHON Mutation Analysis

A T10663C mutation in human MT-ND4L causes Val65Ala substitution, disrupting proton pumping and ATP synthesis. Recombinant Gadus morhua ND4L provides a comparative model to study evolutionary conservation of this mechanism .

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade activity; glycerol stabilization is recommended .

  • Functional Studies: Further research is needed to resolve how ND4L mutations specifically impair optic nerve function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Gadus morhua (Atlantic cod)
Target Names
Target Protein Sequence
MTPTHFTISSAFLLGMMGLAFHRTHLLSALLCLEAMMLALFIALSLWSLQLDATGCSTAP MLMLAFSACEASAGLALLVATARTHGTDHMQALNLLQC
Uniprot No.

Target Background

Function

Gadus morhua NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L): A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be its immediate electron acceptor.

Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its role in cellular function?

MT-ND4L (mitochondrially encoded NADH 4L dehydrogenase) is a protein component of Complex I in the mitochondrial respiratory chain. This protein enables NADH dehydrogenase (ubiquinone) activity and is involved in the critical first step of electron transport from NADH to ubiquinone . It plays an essential role in oxidative phosphorylation, which creates an electrical charge difference across the inner mitochondrial membrane to drive ATP production . In Atlantic cod (Gadus morhua), MT-ND4L is encoded by mitochondrial DNA and contributes to the species' energy metabolism in cellular respiration .

What is the structural composition of recombinant Gadus morhua MT-ND4L?

Recombinant Gadus morhua MT-ND4L consists of 98 amino acids (full length protein) . The amino acid sequence is characterized by hydrophobic regions that facilitate embedding within the inner mitochondrial membrane. The protein typically includes transmembrane domains that contribute to proton translocation across the membrane. Commercial recombinant versions of this protein may include affinity tags to facilitate purification and detection, though the specific tag type may vary depending on the production process . The protein is typically stored in a Tris-based buffer with 50% glycerol to maintain stability .

How is recombinant MT-ND4L produced for research applications?

Recombinant MT-ND4L is typically produced using bacterial expression systems, primarily E. coli, similar to the expression system used for the related MT-ND6 protein . The process involves:

  • Cloning the MT-ND4L gene sequence into an appropriate expression vector

  • Transformation of the vector into a competent bacterial strain

  • Induction of protein expression under controlled conditions

  • Cell lysis and protein extraction

  • Purification using affinity chromatography (utilizing tags such as His-tag)

  • Quality control testing including SDS-PAGE to confirm purity (>90% purity is standard)

  • Lyophilization or buffer stabilization for storage

The final product is typically stored as a lyophilized powder or in a stabilizing buffer containing glycerol to prevent degradation during freeze-thaw cycles .

What are the recommended storage and handling conditions for recombinant MT-ND4L?

For optimal stability and activity retention of recombinant MT-ND4L, the following storage and handling protocols are recommended:

  • Long-term storage: Store at -20°C or -80°C in aliquots to minimize freeze-thaw cycles

  • Working aliquots: Can be maintained at 4°C for up to one week

  • Reconstitution: When using lyophilized protein, briefly centrifuge the vial before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Stabilization: Add glycerol to a final concentration of 5-50% after reconstitution for improved stability

  • Avoid repeated freeze-thaw cycles as they can significantly reduce protein activity

These conditions maintain the structural integrity and enzymatic activity of the recombinant protein for research applications.

What experimental approaches can be used to study MT-ND4L function in mitochondrial Complex I?

Multiple sophisticated experimental approaches can be employed to investigate MT-ND4L function within Complex I:

  • In vitro reconstitution assays: Incorporate purified recombinant MT-ND4L into artificial membrane systems to measure electron transport activity using spectrophotometric methods to monitor NADH oxidation rates.

  • Site-directed mutagenesis: Generate specific mutations in MT-ND4L corresponding to those found in mitochondrial disorders to study structure-function relationships. This is particularly relevant for studying the T10663C (Val65Ala) mutation associated with Leber hereditary optic neuropathy .

  • Protein-protein interaction studies: Use crosslinking experiments, co-immunoprecipitation, or proximity labeling techniques to identify interaction partners within Complex I.

  • Electron microscopy and structural analysis: Apply cryo-EM techniques to visualize MT-ND4L's position and conformational changes within the assembled Complex I structure.

  • Oxygen consumption measurements: Employ high-resolution respirometry to quantify the impact of MT-ND4L variants on mitochondrial oxygen consumption and electron transport efficiency .

These approaches collectively provide a comprehensive understanding of MT-ND4L's functional role in mitochondrial energy production.

How can transcriptional analysis be used to study MT-ND4L expression in Gadus morhua?

Transcriptional analysis of MT-ND4L in Gadus morhua requires specialized approaches due to its bicistronic nature and mitochondrial origin:

  • RT-PCR sequencing: Apply reverse transcription with poly(A)-specific reverse primers followed by gene-specific amplification to map the 3' end of MT-ND4L transcripts . This approach has revealed that ND4L/ND4 form a bicistronic transcript in gadid fishes .

  • RNA-Seq analysis: Use next-generation sequencing to quantify MT-ND4L expression levels across different tissues or experimental conditions while accounting for its overlap with ND4.

  • Polysome profiling: Employ this technique to examine translation efficiency of the bicistronic ND4L/ND4 transcript, especially to understand how ribosomes manage the transition between the two coding regions.

  • Northern blot analysis: Use specific probes to detect the full bicistronic transcript containing both ND4L and ND4, which can provide insights into transcript stability and processing.

  • 3' RACE (Rapid Amplification of cDNA Ends): Map polyadenylation sites in the MT-ND4L/ND4 transcript to understand post-transcriptional processing mechanisms .

These methods have revealed that gadid MT-ND4L/ND4 transcripts follow the punctuation model with polyadenylation sites corresponding to the 5' end of downstream tRNAs, and that stop codons are frequently generated through post-transcriptional polyadenylation .

What are the challenges in studying recombinant MT-ND4L protein compared to other mitochondrial proteins?

Studying recombinant MT-ND4L presents several unique challenges compared to other mitochondrial proteins:

  • Hydrophobicity: MT-ND4L is highly hydrophobic, making expression, purification, and solubilization difficult. Special detergent formulations or membrane-mimetic systems are often required to maintain proper folding.

  • Context-dependent function: As part of Complex I, MT-ND4L's function depends on interactions with other subunits, making isolated protein studies potentially less physiologically relevant.

  • Small size: At only 98 amino acids in Gadus morhua, MT-ND4L's small size can present challenges for detection and purification .

  • Bicistronic transcript nature: The bicistronic expression of ND4L/ND4 in gadids complicates gene manipulation strategies and expression studies .

  • Species-specific variations: Significant differences exist between fish and mammalian mitochondrial gene organization and expression, requiring species-specific approaches rather than direct application of mammalian model techniques .

Researchers often address these challenges by using specific tags, optimized buffer conditions, and specialized purification protocols tailored to hydrophobic membrane proteins.

How can recombinant MT-ND4L be used to study mitochondrial diseases?

Recombinant MT-ND4L serves as a valuable tool for investigating mitochondrial diseases through several advanced approaches:

  • Mutation modeling: Generate recombinant MT-ND4L variants containing disease-associated mutations, such as the T10663C (Val65Ala) mutation linked to Leber hereditary optic neuropathy (LHON) , to study functional impacts on:

    • Protein stability and folding

    • Electron transport efficiency

    • Complex I assembly

  • Antibody development: Use purified recombinant protein as an antigen to develop specific antibodies for:

    • Immunohistochemical analysis of patient tissues

    • Quantifying protein levels in disease states

    • Detecting abnormal cellular localization

  • Drug screening platforms: Employ recombinant protein in high-throughput screens to identify:

    • Compounds that rescue mutant protein function

    • Molecules that enhance residual Complex I activity

    • Potential therapeutic agents for mitochondrial disorders

  • Structural studies: Utilize recombinant protein for structural determination to:

    • Identify critical functional domains affected in disease

    • Understand how mutations disrupt protein-protein interactions

    • Guide rational drug design for therapeutic intervention

These approaches facilitate the translation of basic research into clinical applications for mitochondrial diseases associated with MT-ND4L dysfunction.

How does Gadus morhua MT-ND4L differ from human MT-ND4L in structure and function?

Comparative analysis between Gadus morhua and human MT-ND4L reveals several key differences and similarities:

FeatureGadus morhua MT-ND4LHuman MT-ND4LFunctional Significance
Amino acid length98 amino acids 98 amino acidsConserved protein size despite evolutionary distance
Transmembrane domainsMultiple hydrophobic regionsMultiple hydrophobic regionsSimilar membrane integration pattern
mRNA characteristicsPart of bicistronic transcript with ND4 Part of bicistronic transcript with ND4Conserved gene organization
PolyadenylationPost-transcriptional polyadenylation generates stop codons Similar post-transcriptional modificationConserved RNA processing mechanism
Disease associationsLimited data on fish-specific pathologiesAssociated with LHON and diabetes mellitus Different clinical manifestations
Evolutionary conservationMore similar to other fish speciesMore similar to other mammalsReflects evolutionary divergence

These differences have implications for using Gadus morhua MT-ND4L as a model for human mitochondrial diseases, requiring careful consideration of the evolutionary conservation of functional domains when extrapolating findings between species.

What analytical techniques can be used to assess the quality and activity of recombinant MT-ND4L?

Multiple analytical techniques can be employed to comprehensively assess recombinant MT-ND4L quality and functional activity:

  • Protein quality assessment:

    • SDS-PAGE for purity determination (>90% is standard)

    • Mass spectrometry for exact molecular weight verification and post-translational modification analysis

    • Circular dichroism spectroscopy to evaluate secondary structure integrity

    • Thermal shift assays to determine protein stability

  • Functional activity assays:

    • NADH:ubiquinone oxidoreductase activity assays measuring electron transfer rates

    • Spectrophotometric monitoring of NADH oxidation at 340 nm

    • Oxygen consumption measurements using high-resolution respirometry

    • Proton pumping assays in reconstituted membrane systems

  • Interaction analysis:

    • Surface plasmon resonance to measure binding to other Complex I subunits

    • Isothermal titration calorimetry for thermodynamic characterization of interactions

    • Native PAGE to assess complex formation

  • Structural integrity:

    • Limited proteolysis to evaluate proper folding

    • Fluorescence spectroscopy to monitor conformational changes

    • HDX-MS (hydrogen-deuterium exchange mass spectrometry) to analyze protein dynamics

These techniques collectively provide a comprehensive assessment of recombinant MT-ND4L quality and functionality for research applications.

How can gene editing techniques be applied to study MT-ND4L function in model organisms?

Studying mitochondrial genes like MT-ND4L presents unique challenges for gene editing due to their location in the mitochondrial genome. Several specialized approaches can be employed:

  • Mitochondrially-targeted nucleases:

    • Use TALENs or ZFNs with mitochondrial targeting sequences to introduce specific mutations

    • Apply modified CRISPR systems with specialized delivery mechanisms to target mtDNA

    • Implement base editors optimized for mitochondrial targeting

  • Allotopic expression systems:

    • Reconfigure the MT-ND4L gene for nuclear expression with appropriate mitochondrial targeting sequences

    • Use this approach to introduce wild-type or mutant versions of MT-ND4L into cells with dysfunctional mitochondrial genes

    • Evaluate functional complementation to assess protein activity

  • Cytoplasmic hybrid (cybrid) cell lines:

    • Create cell lines containing mitochondria from different sources to study the impact of specific MT-ND4L variants

    • Useful for comparing wild-type and mutant MT-ND4L function in identical nuclear backgrounds

  • RNA import strategies:

    • Develop systems to import functional RNA transcripts into mitochondria to bypass traditional editing limitations

    • Use modified tRNAs as vectors for therapeutic RNA delivery

These approaches have varying degrees of efficiency and applicability depending on the model organism and specific research question, with mitochondrially-targeted nucleases showing increasing promise for direct mtDNA editing.

What are the emerging research directions for MT-ND4L in the context of evolutionary biology and climate adaptation?

MT-ND4L research is expanding into evolutionary biology and climate adaptation studies, particularly in marine species like Gadus morhua:

  • Thermal adaptation:

    • Investigation of MT-ND4L sequence variations across fish populations from different thermal environments

    • Functional analysis of how these variations affect Complex I efficiency at different temperatures

    • Study of the protein's role in metabolic adaptation to changing ocean temperatures

  • Population genetics and conservation:

    • Analysis of MT-ND4L as a marker for population structure in commercially important fish species

    • Evaluation of genetic diversity in this gene as an indicator of population health

    • Application to conservation genetics for vulnerable fish populations

  • Comparative mitogenomics:

    • Detailed comparison of MT-ND4L structure and function across diverse fish lineages

    • Investigation of selection pressures on this gene through evolutionary time

    • Analysis of coevolution patterns between MT-ND4L and other Complex I components

  • Bioenergetic adaptations:

    • Examination of how MT-ND4L variants contribute to differences in metabolic efficiency

    • Study of potential roles in adaptation to different oxygen levels

    • Investigation of energy production optimization in species facing environmental stressors

These emerging research directions leverage MT-ND4L as a model for understanding the molecular basis of adaptation and evolution in changing marine environments, with potential applications to biodiversity conservation and climate change impact assessment.

What are common challenges in experimental studies using recombinant MT-ND4L and how can they be addressed?

Researchers working with recombinant MT-ND4L commonly encounter several technical challenges that can be addressed through specialized approaches:

ChallengeCauseSolution Strategy
Low expression yieldHydrophobicity and potential toxicity to expression hostsUse specialized bacterial strains (C41/C43); lower induction temperature; optimize codon usage for expression host
Protein aggregationImproper folding of hydrophobic domainsInclude mild detergents in lysis and purification buffers; use membrane-mimetic systems like nanodiscs or liposomes
Poor solubilityIntrinsic membrane protein characteristicsOptimize detergent selection; use fusion partners to enhance solubility; consider refolding from inclusion bodies
Purification difficultiesLow abundance and challenging separationImplement two-stage purification with affinity chromatography followed by size exclusion; use appropriate tag systems
Activity loss during storageProtein instabilityStore in glycerol-containing buffer (50%); aliquot to avoid freeze-thaw cycles; maintain at -80°C for long-term storage
Inconsistent functional assaysContextual dependence of activityReconstitute with other Complex I components; use lipid bilayers to mimic native environment

These strategies help overcome the inherent difficulties associated with studying this hydrophobic mitochondrial protein while maintaining its structural integrity and functional properties.

How can researchers differentiate between the effects of MT-ND4L mutations and other Complex I components in functional studies?

Distinguishing the specific effects of MT-ND4L mutations from those of other Complex I components requires sophisticated experimental design:

  • Reconstitution experiments:

    • Create minimal functional units containing MT-ND4L and essential partner subunits

    • Systematically swap wild-type and mutant components to isolate specific effects

    • Measure defined activities (electron transfer, proton pumping) in controlled environments

  • Complementation approaches:

    • Express wild-type MT-ND4L in systems with mutant endogenous protein

    • Quantify the degree of functional rescue to determine mutation severity

    • Use allotopic expression (nuclear-encoded mitochondrially-targeted proteins) for controlled studies

  • Structure-based analysis:

    • Map mutations on high-resolution structures of Complex I

    • Predict impacts on specific interactions with neighboring subunits

    • Validate predictions through site-directed mutagenesis of interaction interfaces

  • Biophysical measurements:

    • Conduct electron paramagnetic resonance (EPR) to monitor specific electron transfer steps

    • Use fluorescence resonance energy transfer (FRET) to measure distance changes between components

    • Apply hydrogen-deuterium exchange mass spectrometry (HDX-MS) to detect conformational changes

These approaches help isolate MT-ND4L-specific effects within the complex multi-subunit enzyme system, allowing for precise characterization of mutation impacts.

What considerations should be taken when designing experiments to compare mitochondrial function across different species using MT-ND4L as a model?

Cross-species comparisons of mitochondrial function using MT-ND4L require careful experimental design to account for evolutionary differences:

  • Sequence homology assessment:

    • Conduct thorough sequence alignment of MT-ND4L across target species

    • Identify conserved domains versus species-specific regions

    • Focus functional studies on evolutionarily conserved regions for meaningful comparisons

  • Transcriptional context:

    • Account for species differences in gene organization and expression patterns

    • Consider that gadid fishes produce bicistronic ND4L/ND4 transcripts with specific polyadenylation patterns

    • Adjust RNA analysis methods to accommodate species-specific processing mechanisms

  • Environmental adaptation:

    • Control for natural habitat conditions (temperature, oxygen levels, pressure) when comparing species

    • Consider evolutionary adaptations in mitochondrial function (cold-adapted species vs. warm-adapted)

    • Normalize measurements to account for different physiological optima

  • Methodological standardization:

    • Develop consistent isolation protocols for mitochondria across species

    • Standardize functional assays to account for species-specific biochemical properties

    • Use multiple complementary techniques to verify findings across species boundaries

  • Statistical considerations:

    • Apply phylogenetic correction methods to account for evolutionary relationships

    • Include appropriate outgroups and sister species for robust comparative analysis

    • Use sufficient biological replicates to account for intraspecies variation

These considerations ensure that comparative studies generate biologically meaningful insights rather than artifacts of methodological or evolutionary differences.

What are the potential applications of MT-ND4L research in addressing mitochondrial disorders?

Research on MT-ND4L holds promising applications for addressing mitochondrial disorders through several innovative approaches:

  • Gene therapy strategies:

    • Development of allotopic expression systems for delivering functional MT-ND4L to affected tissues

    • Creation of modified mRNA therapeutics targeting MT-ND4L deficiencies

    • Exploration of mitochondrially-targeted CRISPR systems for direct mtDNA editing

  • Biomarker development:

    • Identification of MT-ND4L-specific dysfunction signatures in biofluids

    • Development of sensitive assays to detect mitochondrial dysfunction in early disease stages

    • Creation of prognostic indicators based on MT-ND4L mutation patterns

  • Therapeutic compound screening:

    • Establishment of high-throughput systems using recombinant MT-ND4L for drug discovery

    • Identification of compounds that can bypass or enhance Complex I function

    • Development of targeted approaches to stabilize mutant MT-ND4L proteins

  • Personalized medicine applications:

    • Creation of patient-derived models incorporating specific MT-ND4L mutations

    • Development of mutation-specific therapeutic strategies

    • Implementation of precision approaches for diseases like Leber hereditary optic neuropathy

These research directions aim to translate fundamental understanding of MT-ND4L function into clinical applications for mitochondrial disorders, which currently have limited treatment options.

How might advanced structural biology techniques enhance our understanding of MT-ND4L function?

Advanced structural biology techniques promise to revolutionize our understanding of MT-ND4L function through several approaches:

  • Cryo-electron microscopy (Cryo-EM):

    • Determination of high-resolution structures of MT-ND4L within intact Complex I

    • Visualization of conformational changes during the catalytic cycle

    • Mapping of disease-associated mutations onto functional domains

    • Comparison of structures across species to identify evolutionarily conserved mechanisms

  • Integrative structural biology:

    • Combination of X-ray crystallography, NMR, and computational modeling

    • Development of dynamic models incorporating protein flexibility

    • Integration of functional data with structural information to create comprehensive mechanistic models

  • Time-resolved structural studies:

    • Application of time-resolved cryo-EM or X-ray free electron laser (XFEL) techniques

    • Capturing transient states during electron transfer and proton pumping

    • Understanding the sequence of conformational changes during catalysis

  • In situ structural biology:

    • Visualization of MT-ND4L within intact mitochondria using cryo-electron tomography

    • Study of native protein organization in cellular contexts

    • Analysis of supercomplexes and higher-order assemblies involving Complex I

These advanced techniques will provide unprecedented insights into the molecular mechanisms underlying MT-ND4L function and dysfunction, potentially revealing new therapeutic targets for mitochondrial diseases.

What interdisciplinary approaches could advance MT-ND4L research in coming years?

The future of MT-ND4L research lies in interdisciplinary approaches that integrate various scientific disciplines:

  • Computational biology and artificial intelligence:

    • Implementation of machine learning for predicting mutation effects

    • Development of molecular dynamics simulations to model protein behavior

    • Creation of systems biology models incorporating MT-ND4L in mitochondrial networks

    • Application of AI-driven drug discovery for mitochondrial disorders

  • Single-cell technologies:

    • Analysis of mitochondrial heterogeneity at the single-cell level

    • Investigation of how MT-ND4L mutations affect cellular subpopulations

    • Development of single-organelle proteomics to study mitochondrial composition

  • Synthetic biology:

    • Creation of minimal mitochondrial systems with engineered MT-ND4L variants

    • Development of artificial electron transport chains with modified properties

    • Design of novel energy-generating systems inspired by natural Complex I

  • Evolutionary medicine:

    • Exploration of MT-ND4L variations across populations and their health implications

    • Investigation of adaptive mutations in different environmental contexts

    • Application of comparative genomics to understand disease susceptibility differences

  • Biomaterials and nanotechnology:

    • Development of nanoscale delivery systems targeting mitochondria

    • Creation of biosensors for monitoring MT-ND4L function in living systems

    • Engineering of artificial membranes for studying purified proteins

These interdisciplinary approaches will drive innovation in MT-ND4L research, potentially leading to breakthroughs in understanding mitochondrial function and developing novel therapeutic strategies for mitochondrial disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.