Recombinant Galactosyl transferase CpsE (cpsE)

Shipped with Ice Packs
In Stock

Description

Biochemical Function and Mechanism

CpsE belongs to the glycosyltransferase (GT) family and operates as a phosphogalactosyltransferase or phosphoglucosyltransferase, depending on the organism and serotype. Its primary role is the initiation of CPS synthesis by transferring galactose (Gal) or glucose (Glc) from UDP-Gal or UDP-Glc onto an undecaprenyl phosphate (Und-P) lipid acceptor. This step forms the lipid-linked oligosaccharide precursor for subsequent polymerization and capsule assembly .

Key findings:

  • In GBS serotype V, CpsE deletion leads to severely reduced capsule production, as shown by TEM imaging (Figures 2A–D in ) .

  • In S. pneumoniae, Cps2E (a functional homolog of CpsE) exhibits conserved residues critical for activity, with mutations in the extracytoplasmic loop disrupting CPS synthesis .

  • CpsE activity requires divalent metal cations (e.g., Mg²⁺ or Mn²⁺), coordinated via a DXD motif, a hallmark of GT-A superfamily enzymes .

Role in Pathogenicity and Immune Evasion

CpsE is essential for capsule-mediated virulence in Streptococcus species. The capsule prevents phagocytosis and complement activation by mimicking host sialic acids (Sia) via terminal Sia residues .

Experimental Evidence:

  • GBS ΔcpsE mutants show enhanced phagocytosis by human placental macrophages (+42% uptake) .

  • Biofilm Deficiency: CpsE deletion reduces biofilm formation, impairing colonization in reproductive tracts .

  • Serotype-Specific Virulence: In S. pneumoniae, Cps2E mutations correlate with capsule loss and reduced pathogenicity .

Research Applications and Challenges

CpsE is a priority target for antimicrobial therapies due to its conserved role across Streptococcus serotypes. Challenges include:

  • Structural Complexity: Limited high-resolution crystal structures hinder drug design.

  • Off-Target Effects: Inhibition could disrupt essential bacterial processes (e.g., peptidoglycan synthesis) .

Innovative Approaches:

  • Subtractive Genomics: Identifying CpsE-specific metabolic pathways for targeted disruption .

  • In Vitro Assays: Recombinant CpsE enzymes enable biochemical characterization of substrate specificity and inhibition .

Comparative Analysis with Related Enzymes

CpsE shares functional similarities with other GTs but exhibits distinct substrate preferences and regulatory mechanisms:

EnzymeOrganismActivityKey Difference from CpsE
Cps2ES. pneumoniaeInitiates CPS synthesisTargets UDP-Glc; lacks CpsE’s Gal specificity
WciNS. pneumoniaeα-1,3-galactosyltransferaseRequires UDP-Gal; distinct acceptor recognition
EpsES. thermophilusPhosphogalactosyltransferaseInitiates exopolysaccharide synthesis

Future Directions

  • Therapeutic Inhibition: Small-molecule inhibitors targeting the DXD motif or extracytoplasmic loop.

  • Vaccine Development: CpsE as a candidate antigen for universal Streptococcus vaccines.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
cpsE; SAG1171; Galactosyl transferase CpsE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-449
Protein Length
full length protein
Species
Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Target Names
cpsE
Target Protein Sequence
MIQTVVVYFSASLTLTLITPNFKSNKDLLFVLLIHYIVFYLSDFYRDFWSRGYLEEFKMV LKYSFYYIFISSSLFFIFKNSFTTTRLSFFTFIAMNSILLYLLNSFLKYYRKYSYAKFSR DTKVVLITNKDSLSKMTFRNKYDHNYIAVCILDSSEKDCYDLKHNSLRIINKDALTSELT CLTVDQAFINIPIELFGKYQIQDIINDIEAMGVIVNVNVEALSFDNIGEKRIQTFEGYSV ITYSMKFYKYSHLIAKRFLDITGAIIGLLICGIVAIFLVPQIRKDGGPAIFSQNRVGRNG RIFRFYKFRSMRVDAEQIKKDLLVHNQMTGLMFKLDDDPRITKIGKFIRKTSIDELPQFY NVLKGDMSLVGTRPPTVDEYEKYNSTQKRRLSFKPGITGLWQISGRNNITDFDEIVKLDV QYINEWSIWSDIKIILLTLKVVLLGTGAK
Uniprot No.

Target Background

Function
Galactosyl transferase is crucial for the assembly of the group B streptococci (GBS) type III capsular polysaccharide. It may participate in the formation of one or both galactosidic bonds by catalyzing the addition of galactose to an oligosaccharide precursor or a lipid intermediate. Type III capsular polysaccharide comprises a linear backbone with short side chains terminating in residues of N-acetylneuraminic acid or sialic acid. The presence of sialic acid on the bacterial surface inhibits activation of the alternative pathway of complement, which is believed to be a key factor in the capsule's virulence function.
Database Links

KEGG: sag:SAG1171

Protein Families
Bacterial sugar transferase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Galactosyl transferase CpsE and what is its role in bacterial physiology?

Galactosyl transferase CpsE (cpsE) is a key enzyme involved in the synthesis of capsular polysaccharides (CPS) in Streptococcus agalactiae (Group B Streptococcus, GBS). It functions as a glycosyltransferase that catalyzes the first step in capsular biosynthesis by transferring a monosaccharide to an undecaprenyl phosphate acceptor to initiate assembly of the oligosaccharide repeating unit .

CpsE is encoded by the cpsE gene within the capsule polysaccharide synthesis (cps) operon. In serotype V GBS, CpsE is essential for capsule production, contributing significantly to bacterial virulence through:

  • Facilitating biofilm formation

  • Enhancing immune evasion (particularly against phagocytosis by placental macrophages)

  • Supporting colonization and ascension of the reproductive tract during pregnancy

  • Contributing to bacterial survival in host tissues

What are the optimal conditions for expressing recombinant CpsE in E. coli?

When expressing recombinant CpsE in E. coli, the following methodological approach is recommended:

  • Vector Selection: Use expression vectors containing His-tags (either N-terminal or C-terminal) to facilitate purification. Vectors like pQE60 with NcoI and BamHI restriction sites have been successfully used .

  • E. coli Strain Selection:

    • For construct verification and initial cloning: E. coli XL1-Blue

    • For protein expression: E. coli DH5α

  • Induction Parameters:

    • Grow cultures to mid-log phase (OD600 = 0.6-0.8)

    • Induce with IPTG (0.5-1.0 mM)

    • Post-induction temperature: 25-30°C (rather than 37°C) to enhance soluble protein yield

    • Induction time: 4-6 hours or overnight at reduced temperatures

  • Cell Lysis:

    • Sonication in buffer containing PBS pH 7.4 with protease inhibitors

    • Alternative: Homogenization under pressure for membrane-associated protein extraction

  • Solubility Enhancement:

    • Consider co-expression with chaperones if solubility is an issue

    • Addition of mild detergents (0.1-0.5% NLS) can help solubilize membrane-associated forms of CpsE

Research indicates that coexpression of CpsE with other glycosyltransferases like EpsG (in the case of S. thermophilus) may be necessary for proper activity assessment in some experimental systems .

What purification strategies yield the highest purity and activity for recombinant CpsE?

A multi-step purification approach is recommended for obtaining high-purity, active recombinant CpsE:

  • Affinity Chromatography (Primary purification):

    • For His-tagged constructs: Ni-NTA or IMAC columns with imidazole gradient elution

    • Binding buffer: 50 mM sodium phosphate, pH 7.4, 300 mM NaCl, 10 mM imidazole

    • Washing buffer: Same with 20 mM imidazole

    • Elution buffer: Same with 250-300 mM imidazole gradient

  • Size Exclusion Chromatography (Secondary purification):

    • Superdex 75 or 200 columns depending on oligomerization state

    • Buffer: PBS pH 7.4 or 20 mM Tris-HCl pH 8.0, 150 mM NaCl

  • Buffer Exchange and Concentration:

    • Dialysis against storage buffer (PBS with 4% Trehalose, 1% Mannitol)

    • Concentration using 10K MWCO centrifugal filters

  • Quality Control Checkpoints:

    • SDS-PAGE: Should show >90% purity with expected molecular weight band

    • Western blot: Confirmation using anti-His or CpsE-specific antibodies

    • Activity assay: Using UDP-galactose as donor and appropriate acceptor substrates

  • Storage Conditions:

    • Lyophilization is recommended for long-term storage

    • For working aliquots, store at -20°C/-80°C in buffer containing cryoprotectants (4-6% Trehalose)

    • Avoid repeated freeze-thaw cycles

How can I measure the enzymatic activity of recombinant CpsE in vitro?

The enzymatic activity of recombinant CpsE can be measured using several complementary approaches:

  • Radio-labeled UDP-Gal Incorporation Assay:

    • Reaction mixture: Recombinant CpsE, UDP-[14C]Gal or UDP-[3H]Gal, appropriate acceptor substrate, divalent cation (Mn2+ or Mg2+), buffer (pH 7.2-7.4)

    • Incubation: 30-60 minutes at 30-37°C

    • Detection: Scintillation counting after product separation by paper chromatography or precipitation

  • Coupled Enzyme Assay:

    • Measuring UDP release using pyruvate kinase and lactate dehydrogenase

    • NADH oxidation can be monitored at 340 nm as a measure of enzyme activity

    • Reaction contains: CpsE, UDP-Gal, acceptor, PEP, NADH, pyruvate kinase and lactate dehydrogenase

  • HPLC-based Detection:

    • Reaction mixture: CpsE, UDP-Gal, acceptor substrate, buffer

    • Separation of products by HPLC

    • Detection methods: UV absorption, fluorescence (for labeled substrates), or mass spectrometry

  • Fluorescence-based Assays:

    • Using fluorescently labeled acceptor substrates

    • Monitoring changes in fluorescence properties upon galactosylation

    • Can be adapted for high-throughput screening

  • Capillary Electrophoresis:

    • Separation of reaction products based on charge/mass ratio

    • Offers high resolution for complex mixtures

    • Especially useful for analyzing various reaction products

For maximum activity, the reaction buffer should contain:

  • 50 mM HEPES or Tris-HCl (pH 7.4)

  • 10-25 mM MnCl2 or MgCl2

  • 0.1-0.5% detergent (if needed for solubility)

  • 1-5 mM UDP-Gal

  • Appropriate acceptor substrate concentration

What are the optimal substrates and reaction conditions for CpsE activity?

The optimal conditions for CpsE activity are:

ParameterOptimal ConditionNotes
pH7.2-7.5Activity decreases significantly below pH 6.5 or above pH 8.0
Temperature30-37°CBalance between enzyme stability and activity
Metal ionsMn2+ (10-20 mM)Mg2+ can substitute but with lower activity
Donor substrateUDP-GalactoseKm typically in the low micromolar range
Acceptor substrateUndecaprenyl phosphate or analoguesFor initial glycosylation step
BufferHEPES or Tris-HCl (50 mM)Phosphate buffers may inhibit activity
Detergent0.05-0.1% NLS or Triton X-100Only if required for solubility
Incubation time30-60 minutesLonger times may not increase product formation linearly

CpsE specificities:

  • Exhibits high specificity for UDP-Galactose as the donor substrate

  • In GBS serotype V, transfers galactose to undecaprenyl phosphate acceptor

  • May show differences in acceptor specificity between serotypes

Research by Stinglebaum et al. (1999) demonstrated that S. thermophilus EpsE (homologous to GBS CpsE) could transfer galactose to lipid carriers but required co-expression with EpsG for complete activity in complex formation .

How does CpsE contribute to bacterial virulence and immune evasion?

CpsE plays a critical role in bacterial virulence through several mechanisms:

  • Capsule Biosynthesis:

    • CpsE initiates capsule polysaccharide synthesis by transferring the first sugar to the lipid carrier

    • Deletion of cpsE results in severely attenuated capsule production as shown in electron microscopy studies

    • The capsule is essential for bacterial survival in host environments

  • Immune Evasion:

    • Studies with ΔcpsE mutants show 42% enhancement in phagocytosis by human placental macrophages compared to wild-type strains

    • The capsule prevents complement deposition and recognition by immune cells

    • CpsE-dependent capsule inhibits opsonophagocytosis by neutrophils and macrophages

  • Biofilm Formation:

    • CpsE deletion results in 60% reduction in biofilm formation capacity (P=0.0039)

    • ΔcpsE mutants show sparse adhesion to abiotic surfaces compared to wild-type strains

    • Biofilms protect bacteria from antimicrobial agents and host defenses

  • Carbohydrate Secretion:

    • CpsE facilitates carbohydrate secretion into the extracellular matrix

    • Mutants lacking cpsE show diminished carbohydrate:protein ratios in biofilm studies

    • These extracellular carbohydrates contribute to immunomodulation and protection

  • Reproductive Tract Colonization:

    • In mouse models, ΔcpsE mutants show a 3-log decrease in bacterial burden in vaginal and uterine tissues

    • A 4-log decrease was observed in decidua, placenta, fetal membrane, and fetal tissues

    • This demonstrates the critical role of CpsE in ascending infection during pregnancy

What phenotypic changes are observed in bacterial strains with cpsE gene deletion or mutation?

Deletion of the cpsE gene results in numerous phenotypic changes that affect bacterial fitness and virulence:

  • Morphological Changes:

    • Severe reduction in capsule thickness visualized by negative stain transmission electron microscopy

    • Altered cell surface architecture

    • Changes in colony morphology (smaller, less mucoid colonies)

  • Growth Characteristics:

    • No significant difference in growth rate in standard laboratory media

    • Reduced survival in blood, serum, or in the presence of antimicrobial peptides

    • Increased susceptibility to environmental stressors

  • Biofilm Formation:

    • 60% reduction in biofilm formation capacity in static culture conditions

    • Sparse adherence to abiotic surfaces observed by scanning electron microscopy

    • Altered biofilm architecture with reduced extracellular matrix

  • Carbohydrate Production:

    • Diminished carbohydrate secretion into biofilms

    • Reduced calcofluor white staining (blue fluorescence) in confocal laser scanning microscopy

    • Lower carbohydrate:protein ratio in quantitative assays

  • Immune Interactions:

    • 42% increase in phagocytosis by human placental macrophages

    • Enhanced susceptibility to complement-mediated killing

    • Increased recognition by pattern recognition receptors

  • Virulence in Animal Models:

    • 3-log decrease in bacterial burden in vaginal and uterine tissues in pregnant mouse models

    • 4-log decrease in decidua, placenta, fetal membrane, and fetal tissues

    • Reduced tissue destruction and inflammation in histopathological analyses

    • Diminished capacity to cause ascending infection during pregnancy

  • Genetic Compensation:

    • No changes in transcription of the rest of the cps operon

    • No compensatory upregulation of other galactosyltransferases

How can recombinant CpsE be used for vaccine development?

Recombinant CpsE has significant potential for vaccine development through several strategic approaches:

  • Attenuated Live Vaccine Candidates:

    • ΔcpsE mutant strains show significantly reduced virulence while maintaining immunogenicity

    • Similar to S. pneumoniae studies where a cpsE-endA double mutant showed 23-fold attenuation of virulence while generating protective immunity

    • Advantages: Natural adjuvant properties, stimulation of multiple immune pathways

    • Challenges: Regulatory concerns with live attenuated vaccines, potential reversion to virulence

  • Subunit Vaccine Development:

    • Recombinant CpsE protein can be used as a vaccine antigen

    • Can be combined with other capsular proteins for broader protection

    • Benefits from being highly conserved across multiple GBS serotypes

    • Advantages: Defined composition, potentially safer than live vaccines

    • Challenges: May require adjuvants, potential conformational issues

  • Anti-virulence Approach:

    • Vaccines targeting CpsE function rather than bactericidal activity

    • Aims to reduce virulence potential without applying selective pressure for resistance

    • Could prevent ascending infection without disrupting normal microbiota

    • Particularly relevant for maternal immunization to prevent neonatal GBS disease

  • Serotype-Independent Protection:

    • CpsE-based vaccines may offer protection across multiple GBS serotypes

    • Particularly valuable given "regional shifts in the relative abundance of circulating GBS, potential capsular switching, and the presence of nontypeable strains"

    • Addresses limitations of current capsular polysaccharide conjugate vaccines

  • Adjuvant and Delivery Systems:

    • Recombinant CpsE can be conjugated to carrier proteins like CRM197 or tetanus toxoid

    • Can be incorporated into novel delivery systems like nanoparticles or liposomes

    • These approaches can enhance immunogenicity and target specific immune responses

Research suggests that targeting CpsE through vaccination strategies could be particularly valuable for preventing GBS-associated diseases in pregnancy, where current antibiotic approaches have limitations in preventing preterm birth and late-onset disease .

What are the current challenges in expressing and characterizing glycosyltransferases like CpsE?

Researchers face several significant challenges when working with glycosyltransferases like CpsE:

  • Protein Solubility and Stability Issues:

    • CpsE and similar glycosyltransferases often contain transmembrane domains

    • Expression often results in inclusion bodies or improperly folded proteins

    • Strategies: Use of solubility tags, expression of catalytic domains only, or membrane mimetic systems

    • Challenge: Potential loss of activity when expressing only truncated forms

  • Enzyme Complex Formation Requirements:

    • Many glycosyltransferases function in multi-enzyme complexes

    • For example, studies show CpsE and EpsG must be coexpressed to demonstrate activity:
      "EpsE and EpsG could produce the GalNAc-Gal disaccharide only if they were coexpressed might indicate that the glycosyltransferases form an ordered biosynthetic complex"

    • Challenge: Reconstituting proper protein-protein interactions in recombinant systems

  • Substrate Availability and Specificity:

    • Natural substrates like undecaprenyl phosphate-linked intermediates are difficult to obtain

    • Synthetic substrate analogues may not perfectly mimic natural acceptors

    • Challenge: Developing accessible substrates that accurately reflect in vivo activity

  • Assay Sensitivity and Specificity:

    • Difficulty in developing high-throughput activity assays

    • Traditional radioactive assays have safety concerns

    • Need for specialized equipment for product detection

    • Challenge: Creating sensitive, non-radioactive assays applicable across different systems

  • Structural Characterization:

    • Membrane association complicates crystallization

    • Large size and flexibility can impede structural determination

    • Few structures of bacterial glycosyltransferases in complex with substrates

    • Challenge: Obtaining structural information to guide rational engineering

  • Heterogeneity in Expression Systems:

    • E. coli expression may lack proper post-translational modifications

    • Eukaryotic expression systems like HEK293 cells may provide better folding but lower yield

    • Challenge: Balancing yield with proper folding and modifications

  • Mechanistic Understanding:

    • Controversy remains about exact catalytic mechanisms

    • Difficulties in capturing enzyme-substrate intermediate states

    • Challenge: Elucidating precise mechanisms of glycosyl transfer

Researchers addressing these challenges often employ multidisciplinary approaches combining protein engineering, synthetic biology, and advanced analytical techniques to overcome the inherent difficulties in working with these complex enzymes.

How does CpsE compare structurally and functionally to other bacterial galactosyltransferases?

CpsE shares structural and functional features with other bacterial galactosyltransferases while maintaining unique characteristics:

  • Structural Conservation:

    • Like other glycosyltransferases (GTs), CpsE belongs to the GT-B fold family

    • Contains two Rossmann-like domains with a catalytic site in the cleft between them

    • Shares the DXD motif common to many metal-dependent glycosyltransferases

    • Contains a characteristic N-terminal transmembrane domain followed by a stem region and catalytic domain

  • Comparative Analysis with β-1,4-Galactosyltransferases:

FeatureCpsEβ4Gal-T1 (Human)EpsE (S. thermophilus)
Fold typeGT-BGT-AGT-B
Metal dependencyMn2+ preferredMn2+ requiredMn2+ preferred
Donor substrateUDP-GalUDP-GalUDP-Gal
Primary acceptorUndecaprenyl-PGlcNAcLipid carrier
Transmembrane domainPresentPresentPresent
Flexible loop regionPresentPresent (conformational change upon binding)Present
Anomeric configurationRetainingInvertingRetaining
DimerizationLikelyObservedRequired for function with EpsG
  • Functional Similarities and Differences:

    • Like EpsE from S. thermophilus, CpsE transfers the first sugar to a lipid carrier

    • Unlike human β4Gal-T1, CpsE does not interact with α-lactalbumin to alter acceptor specificity

    • Similar to other bacterial GTs, CpsE functions in capsular polysaccharide synthesis rather than N-glycan processing

    • Studies suggest CpsE may require interaction with other glycosyltransferases for complete function, similar to EpsE/EpsG interactions in S. thermophilus

  • Evolutionary Conservation:

    • CpsE belongs to glycosyltransferase family 2 (GT2) in the CAZy classification

    • Shares homology with glycosyltransferases across bacterial species

    • Core catalytic domain is more conserved than N-terminal regions

    • More closely related to bacterial glycosyltransferases than eukaryotic counterparts

What insights can be gained from studying CpsE mutations across different bacterial serotypes?

Studying CpsE mutations across different bacterial serotypes provides valuable insights into:

  • Serotype-Specific Capsule Biosynthesis:

    • CpsE function is essential for capsule formation in serotype V, and similar importance has been demonstrated in serotype Ia

    • Different serotypes exhibit variations in the cpsE gene sequence that correlate with distinct capsular structures

    • A single nucleotide polymorphism in the homologous cpsE gene in S. pneumoniae (C to G at position 1135) renders the enzyme inactive, demonstrating the critical nature of specific residues

  • Virulence Determinants:

    • Comparative studies of cpsE across serotypes reveal correlation between specific variants and clinical outcomes

    • Mutations affecting enzyme activity correlate with changes in virulence potential

    • "Variations in capsule-associated serotypes have been associated with streptococcal disease outcomes"

  • Host Adaptation Mechanisms:

    • Serotype-specific CpsE variants may reflect adaptation to different host environments

    • Mutations may enable immune evasion by altering capsule structure

    • "The CpsE protein enzymatically inactive. This single nucleotide polymorphism (SNP) is responsible for lack of capsule production"

  • Evolutionary Relationships:

    • Phylogenetic analysis of cpsE sequences provides insights into the evolutionary history of streptococcal species

    • Horizontal gene transfer events can be identified by comparing cpsE sequences

    • Evidence of positive selection in specific regions indicates adaptation to host immune pressure

  • Vaccine Development Strategy:

    • Understanding conserved regions across CpsE variants helps identify universal vaccine targets

    • "Regional shifts in the relative abundance of circulating GBS, potential capsular switching, and the presence of nontypeable strains highlight the need for vaccine strategies that are independent of capsular structure"

    • Identification of invariant epitopes could lead to broad-spectrum protection

  • Structure-Function Relationships:

    • Naturally occurring mutations provide insights into critical functional domains

    • Correlation between specific mutations and phenotypic changes helps identify catalytic residues

    • Comparative mutagenesis studies across serotypes reveal residues critical for substrate recognition

  • Diagnostic Applications:

    • Serotype-specific CpsE variants can be exploited for molecular typing methods

    • PCR-based assays targeting cpsE polymorphisms enable rapid serotype identification

    • Understanding these variations is crucial for epidemiological surveillance

How can recombinant CpsE be utilized for glycoengineering applications?

Recombinant CpsE offers significant potential for glycoengineering applications:

  • Chemo-enzymatic Synthesis of Oligosaccharides:

    • CpsE can be used for the controlled synthesis of defined galactose-containing oligosaccharides

    • The enzyme's regio- and stereospecificity allows precise installation of galactose residues

    • Can be combined with other glycosyltransferases in multi-enzyme cascades for complex oligosaccharide synthesis

    • Advantages over chemical synthesis: No need for protecting groups, high stereo- and regioselectivity

  • In Vitro Glycosylation Systems:

    • Recombinant CpsE can be incorporated into cell-free glycosylation systems

    • Useful for producing defined glycoconjugates for research and therapeutic applications

    • Can be coupled with other enzymes for one-pot multi-step glycosylation reactions

    • Example approach: "The glycosyltransferases in in vitro reactions for the directed biosynthesis of saccharides"

  • Glycan Remodeling:

    • CpsE can be used to modify existing glycan structures

    • Particularly valuable for introducing specific galactose linkages into therapeutic glycoproteins

    • Can enhance or alter biological activities of glycosylated biomolecules

    • Applications in improving pharmacokinetic properties of biologics

  • Designer Polysaccharide Synthesis:

    • Engineering CpsE to accept non-natural substrates enables synthesis of novel polysaccharides

    • These designer polysaccharides can have applications in biomaterials and tissue engineering

    • Can create unique oligosaccharide structures not found in nature

    • Potential for developing new biomaterials with specific properties

  • Glycoconjugate Vaccine Development:

    • Enzymatic synthesis of defined oligosaccharide antigens for conjugate vaccines

    • More consistent than extraction from bacterial cultures

    • Can produce structures that mimic bacterial capsular polysaccharides

    • Applications in developing vaccines against multiple serotypes

  • Diagnostic Tool Development:

    • CpsE-synthesized oligosaccharides can be used as standards or reagents in diagnostic assays

    • Can be incorporated into glycan arrays for antibody profiling

    • Production of serotype-specific antigens for immunoassays

    • Applications in developing new methods for GBS serotyping

  • Understanding Glycobiology:

    • CpsE can be used to synthesize defined structures for studying glycan-protein interactions

    • Valuable tool for understanding the biological roles of specific galactose linkages

    • Enables structure-function studies of glycan recognition by immune receptors

    • "Understanding the role of CpsE in CPS biosynthesis may aid in the development of diagnostic tools"

What approaches can be used to engineer CpsE for altered substrate specificity?

Several approaches can be employed to engineer CpsE for altered substrate specificity:

  • Structure-Guided Mutagenesis:

    • Target residues in the donor and acceptor binding sites based on homology models or crystal structures

    • Focus on residues that interact directly with substrates

    • Conservative substitutions to modify binding pocket size and chemistry

    • Methodology:

      • Generate site-directed mutants using PCR-based methods

      • Express and purify variant enzymes

      • Screen for altered activity using high-throughput glycosyltransferase assays

  • Domain Swapping and Chimeric Enzymes:

    • Exchange domains between CpsE and other glycosyltransferases with desired specificities

    • Create chimeric enzymes combining the CpsE scaffold with binding domains from other GTs

    • Particularly useful for engineering acceptor specificity

    • Example approach: Swap the C-terminal domain of CpsE with that of a β-1,3-galactosyltransferase

  • Directed Evolution:

    • Random mutagenesis of cpsE gene followed by selection for desired activities

    • Methods:

      • Error-prone PCR to introduce random mutations

      • DNA shuffling of related glycosyltransferase genes

      • Selection systems based on glycan display or reporter enzyme activation

    • Requires development of high-throughput screening methods for glycosyltransferase activity

  • Active Site Remodeling:

    • Modification of the metal-binding site to alter metal preference

    • Reshaping the nucleotide-binding pocket to accommodate modified UDP-sugar donors

    • Engineering the acceptor binding site to recognize non-native acceptors

    • Example: Modify the DXD motif to alter metal coordination and catalytic properties

  • Computational Design Approaches:

    • Use molecular dynamics simulations to predict the effects of mutations

    • In silico docking of modified substrates to identify promising enzyme variants

    • Rosetta-based enzyme design to optimize binding interactions

    • Machine learning approaches using data from multiple glycosyltransferases

  • Semi-rational Approaches:

    • Combine structural insights with directed evolution

    • Create focused libraries targeting specific regions

    • Iterative cycles of mutagenesis and screening

    • Saturation mutagenesis of hotspot residues identified from primary structures of related enzymes

  • Protein Engineering for Improved Properties:

    • Engineering for solubility by removing transmembrane domains while maintaining activity

    • Stabilization through introduction of disulfide bonds or consensus mutations

    • Modification of the enzyme's flexibility to accommodate different substrates

    • Approaches similar to those used with human β4Gal-T1, where "specificity of the sugar donor is generally determined by a few residues in the sugar-nucleotide binding pocket"

Examples of success with related glycosyltransferases suggest that CpsE engineering could yield enzymes with novel specificity, improved stability, and enhanced activity for biotechnological applications.

What are common issues in CpsE activity assays and how can they be resolved?

Researchers frequently encounter several challenges when performing CpsE activity assays:

  • Low or No Detectable Activity:

    • Potential causes:

      • Protein misfolding or denaturation

      • Missing cofactors or incorrect buffer conditions

      • Improper substrate preparation

      • Enzyme inhibition by buffer components

    • Solutions:

      • Verify protein integrity by SDS-PAGE and Western blot

      • Ensure fresh preparation of UDP-Gal and acceptor substrates

      • Test multiple buffer conditions (pH 6.5-8.0)

      • Include proper metal cofactors (10-25 mM MnCl₂ or MgCl₂)

      • Consider coexpression with partner glycosyltransferases: "EpsE and EpsG could produce the GalNAc-Gal disaccharide only if they were coexpressed"

  • High Background in Radioactive Assays:

    • Potential causes:

      • Incomplete separation of product from substrate

      • Non-specific binding to filters or matrices

      • Contamination of equipment

    • Solutions:

      • Optimize washing steps and separation protocols

      • Include negative controls (heat-inactivated enzyme)

      • Use higher substrate concentrations to improve signal-to-noise ratio

      • Consider alternative non-radioactive assays

  • Inconsistent Results Between Experiments:

    • Potential causes:

      • Enzyme instability during storage

      • Variation in substrate quality

      • Inconsistent reaction conditions

    • Solutions:

      • Prepare small aliquots of enzyme to avoid freeze-thaw cycles

      • Standardize substrate preparation methods

      • Carefully control temperature and incubation times

      • Include internal standards in each experiment

  • Substrate Limitations:

    • Potential causes:

      • Limited availability of natural acceptors

      • Cost of UDP-Gal

      • Poor solubility of lipid-linked acceptors

    • Solutions:

      • Use synthetic acceptor analogues with improved solubility

      • Incorporate detergents to solubilize lipophilic substrates

      • Consider enzymatic synthesis of UDP-Gal from less expensive precursors

      • Develop regeneration systems for UDP-Gal

  • Interference from Contaminating Activities:

    • Potential causes:

      • Co-purified enzymes with overlapping activities

      • Contaminating phosphatases degrading UDP-Gal

    • Solutions:

      • Include phosphatase inhibitors (e.g., sodium orthovanadate)

      • Further purify enzyme preparations

      • Use specific conditions that favor CpsE activity

      • Design assays that can distinguish between different activities

  • Detection Limitations:

    • Potential causes:

      • Insufficient sensitivity of analytical methods

      • Difficulty separating products from substrates

    • Solutions:

      • Use more sensitive detection methods (mass spectrometry, radiochemical detection)

      • Employ specific antibodies or lectins for product detection

      • Consider coupled enzyme assays that amplify signals

      • Use HPLC or capillary electrophoresis for better separation

How can researchers troubleshoot poor expression or insolubility of recombinant CpsE?

Addressing poor expression or insolubility of recombinant CpsE requires a systematic approach:

  • Expression Vector Optimization:

    • Issues:

      • Inappropriate promoter strength

      • Codon usage mismatch

      • Inefficient translation initiation

    • Solutions:

      • Test different promoters (T7, tac, etc.)

      • Optimize for E. coli codon usage

      • Ensure proper Shine-Dalgarno sequence

      • Try different fusion tags (His, GST, MBP, SUMO)

  • Host Strain Selection:

    • Issues:

      • Incompatibility with expression host

      • Toxicity to standard strains

      • Insufficient tRNA pools for rare codons

    • Solutions:

      • Test multiple E. coli strains (BL21(DE3), Rosetta, Origami)

      • Use strains with extra tRNAs for rare codons

      • Consider strains with enhanced disulfide bond formation

      • Trial host strains with different protease profiles

  • Membrane Protein Expression Challenges:

    • Issues:

      • CpsE contains transmembrane domains

      • Tendency to form inclusion bodies

      • Membrane insertion constraints

    • Solutions:

      • Express soluble domain only (truncate N-terminal region)

      • Use specialized membrane protein expression systems

      • Include mild detergents in lysis buffer (0.5-1% NLS)

      • Consider membrane mimetics (nanodiscs, bicelles)

  • Induction Conditions:

    • Issues:

      • Overly rapid expression leading to misfolding

      • Formation of inclusion bodies

      • Protein degradation

    • Solutions:

      • Lower induction temperature (16-20°C)

      • Reduce IPTG concentration (0.1-0.5 mM)

      • Extend induction time (overnight)

      • Use auto-induction media for gradual expression

  • Solubilization Strategies:

    • Issues:

      • Formation of inclusion bodies

      • Improper folding

      • Aggregation during purification

    • Solutions:

      • Co-expression with chaperones (GroEL/ES, DnaK)

      • Include stabilizing agents (glycerol, arginine, trehalose)

      • Optimize lysis conditions to prevent aggregation

      • Consider on-column refolding techniques

  • Fusion Protein Approaches:

    • Issues:

      • Direct expression yields insoluble protein

      • Poor yield of native protein

    • Solutions:

      • Express as fusion with solubility enhancers (MBP, GST, TrxA)

      • Use SUMO fusion for native N-terminus after cleavage

      • Test dual fusion tags (N- and C-terminal)

      • Optimize linker regions between fusion partner and CpsE

  • Purification Optimization:

    • Issues:

      • Protein aggregation during purification

      • Low yield after tag cleavage

      • Precipitating during buffer exchange

    • Solutions:

      • Include stabilizing agents in all buffers

      • Maintain detergent above critical micelle concentration

      • Use gradient elution to minimize aggregation

      • Test different buffer compositions (pH, salt, additives)

  • Storage Stability:

    • Issues:

      • Loss of activity during storage

      • Precipitation after freeze-thaw

    • Solutions:

      • Add cryoprotectants (trehalose, glycerol)

      • Store in small single-use aliquots

      • Lyophilize with appropriate excipients

      • "Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week"

By systematically addressing these issues, researchers can significantly improve the expression, solubility, and stability of recombinant CpsE for further structural and functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.