Recombinant Galago senegalensis Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Galago senegalensis Cytochrome c oxidase subunit 2 (MT-CO2)

Recombinant Galago senegalensis Cytochrome c oxidase subunit 2 (MT-CO2) refers to a genetically engineered version of the MT-CO2 protein from the northern lesser galago (Galago senegalensis), a widespread nocturnal primate in Africa. This protein is a crucial component of the mitochondrial respiratory chain, specifically part of cytochrome c oxidase (Complex IV), which plays a vital role in the transfer of electrons from cytochrome c to oxygen, ultimately producing water . While specific research on the recombinant form of MT-CO2 from Galago senegalensis is limited, understanding its structure and function can provide insights into its potential applications and significance.

Structure and Function of MT-CO2

The MT-CO2 gene encodes a protein that is part of the cytochrome c oxidase complex, essential for aerobic respiration in eukaryotes . This complex is located in the mitochondrial inner membrane and consists of multiple subunits, with MT-CO2 being one of the core subunits responsible for electron transfer and oxygen reduction . The protein structure includes a binuclear copper A center, which is crucial for its function .

Potential Applications of Recombinant MT-CO2

Recombinant proteins like MT-CO2 can be used in various biotechnological applications, including:

  • Biomedical Research: Studying the recombinant MT-CO2 from Galago senegalensis could provide insights into mitochondrial function and dysfunction, potentially shedding light on diseases related to mitochondrial disorders .

  • Comparative Biology: Comparing the MT-CO2 protein across different species can help understand evolutionary adaptations and differences in metabolic efficiency .

Research Findings and Challenges

While there is no specific research directly focused on the recombinant MT-CO2 from Galago senegalensis, studies on similar proteins in other species highlight the importance of understanding mitochondrial function for insights into metabolic diseases and evolutionary biology . Challenges include the lack of specific data on Galago senegalensis and the need for more research on the genetic and functional aspects of this protein.

Data Tables and Comparative Analysis

SpeciesMT-CO2 FunctionResearch Focus
HumansElectron TransferMitochondrial Diseases
Other PrimatesSimilar to HumansEvolutionary Biology
Galago senegalensisHypotheticalPotential Biomedical Applications

References Svensson et al. (2019). Taxonomic uniformity of Galago senegalensis. Sauther et al. (2024). Climate Challenges for Smaller Primates. Wikipedia. Cytochrome c oxidase subunit 2. NCBI. Galagonidae Genome Assembly. PMC. Reproduction and Breeding of Nonhuman Primates.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Galago senegalensis (Northern lesser bushbaby) (Senegal bushbaby)
Target Names
Target Protein Sequence
MAHAVQYGFQDAAAPIMEELLYFHDHTLMIVFMISSLVLYIISLMLSTELTHTSTMDAQE VETVWTILPAVILILIALPSLRILYMMDEIETPSLTLKTVGHQWYWSYEYTDYDKLCFDS YMTPTPDLEPGDLRLLEVDNRVVLPTEMSIRMLITSEDVLHSWTVPALGIKTDAIPGRLN QATLMTSRVGIYYGQCSEICGANHSYMPIVLELVPLKYFEEWLLKTL
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a crucial component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation by facilitating the transfer of electrons from NADH and succinate to molecular oxygen. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work in concert to generate an electrochemical gradient across the inner mitochondrial membrane, powering transmembrane transport and ATP synthase. Specifically, cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC) in subunit 1, composed of heme A3 and copper B (CuB). The BNC then reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Cytochrome c oxidase subunit 2 in Galago senegalensis?

Cytochrome c oxidase subunit 2 (COII) in Galago senegalensis, like in other primates, encodes a highly conserved protein that is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase (COX). This transfer is crucial to the production of ATP during cellular respiration . The protein forms part of the terminal component of the mitochondrial electron transfer system, which reductively converts molecular oxygen to water coupled with pumping protons across the inner mitochondrial membrane .

In the specific context of Galago senegalensis, a nocturnal primate from sub-Saharan Africa, COII likely plays an important role in maintaining efficient energy production, particularly relevant to their unique physiological adaptations as small-bodied, nocturnal primates that may experience varying metabolic demands across their range of habitats .

How does MT-CO2 sequence conservation in Galago senegalensis compare to other primates?

Galago senegalensis belongs to the lorisiform group of primates, which has shown significant evolutionary divergence in cytochrome c oxidase genes compared to higher primates. Based on comparative studies of primate COII sequences, lorisiforms generally maintain higher sequence conservation than hominoids and Old World monkeys .

The COII gene in higher primates (monkeys and apes) has undergone a nearly two-fold increase in the rate of amino acid replacement relative to other primates, including lorisiforms like Galago senegalensis . While functionally important amino acids are generally conserved across all primates, Galago senegalensis likely maintains more ancestral sequence characteristics compared to the derived patterns seen in higher primates.

A comparative sequence analysis table would typically show:

Primate GroupAmino Acid Substitution RateKey Amino Acid ChangesConservation Pattern
Lorisiforms (incl. G. senegalensis)LowerFewer substitutions at positions 114-115Higher conservation of ancestral sequence
Old World monkeys~2x higher than lorisiformsReplacement of carboxyl-bearing residuesModerate divergence
Hominoids~2x higher than lorisiformsMultiple replacements, especially at N-terminalHighest divergence

What methods are recommended for isolation of MT-CO2 DNA from Galago senegalensis tissues?

For isolation of MT-CO2 DNA from Galago senegalensis, researchers should implement non-invasive sampling techniques whenever possible, particularly when working with wild populations. Based on methodologies developed for galago research, the following protocol is recommended:

  • Sample collection: Obtain hair, fecal samples, or buccal swabs using established non-invasive techniques .

  • DNA extraction:

    • For hair samples: Use a modified chelex extraction protocol optimized for small amounts of hair follicle tissue

    • For fecal samples: Employ specialized kits designed for DNA extraction from fecal material, with modifications to account for galago-specific inhibitors

    • For buccal swabs: Process using standard DNA extraction kits with protocols adjusted for primate samples

  • PCR amplification: Use primers specifically designed for Galago senegalensis MT-CO2, based on conserved regions flanking the gene. Nested PCR approaches may be necessary for samples with low DNA yields .

  • Quality control: Assess DNA purity using spectrophotometric methods and verify amplification specificity through gel electrophoresis and sequencing of PCR products.

What expression systems are most effective for producing functional recombinant Galago senegalensis MT-CO2?

Production of functional recombinant Galago senegalensis MT-CO2 presents significant challenges due to its hydrophobic nature and need for proper folding and assembly within the mitochondrial membrane. Based on studies with cytochrome c oxidase components from other species, the following expression systems are recommended:

  • Mammalian expression systems:

    • HEK293 cells: Provide proper post-translational modifications and membrane insertion machinery

    • CHO cells: Useful for larger-scale production with appropriate folding environment

  • Yeast expression systems:

    • Pichia pastoris: Particularly effective for membrane proteins, allowing proper folding while offering higher yields than mammalian systems

    • Saccharomyces cerevisiae: Useful for functional studies due to similarities in mitochondrial import machinery

  • Cell-free expression systems:

    • Wheat germ extract-based systems supplemented with artificial membranes or nanodiscs can allow direct incorporation of the protein into a lipid environment

Each system requires optimization of codons for Galago senegalensis MT-CO2 sequence, carefully designed purification tags, and expression conditions that minimize aggregation of this highly hydrophobic protein.

How can researchers investigate interaction differences between recombinant Galago senegalensis MT-CO2 and cytochrome c compared to those of higher primates?

To investigate the unique interaction characteristics between Galago senegalensis MT-CO2 and cytochrome c compared to higher primates, researchers should implement the following methodological approach:

  • Protein preparation:

    • Express and purify recombinant MT-CO2 from Galago senegalensis using mammalian expression systems

    • Similarly prepare MT-CO2 from representative higher primates (e.g., human, chimpanzee)

    • Express and purify cytochrome c from multiple primate species

  • Binding affinity analysis:

    • Employ surface plasmon resonance (SPR) to quantify binding kinetics (kon and koff rates)

    • Use isothermal titration calorimetry (ITC) to determine thermodynamic parameters (ΔH, ΔS, and KD)

  • Structural analysis:

    • Perform hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Conduct crosslinking studies followed by mass spectrometry to identify specific contact residues

  • Functional assays:

    • Develop reconstituted enzyme activity assays measuring electron transfer rates

    • Create a matrix of cross-species interactions (e.g., Galago MT-CO2 with human cytochrome c and vice versa)

This approach would specifically address the observed phenomenon that higher primates show poor enzyme kinetics in cross-reactions between cytochromes c and cytochrome c oxidases of higher primates and other mammals, potentially related to the replacement of two carboxyl-bearing residues (glutamate and aspartate) at positions 114 and 115 .

What experimental design would best elucidate the role of MT-CO2 in Galago senegalensis' metabolic adaptations to its ecological niche?

An optimal experimental design to investigate the role of MT-CO2 in Galago senegalensis' metabolic adaptations would integrate multiple approaches:

  • Comparative sequence and structural analysis:

    • Sequence MT-CO2 from Galago senegalensis populations across different ecological habitats

    • Correlate sequence variations with environmental parameters (temperature ranges, altitude, food availability)

    • Model protein structure to identify functional implications of any variants

  • Physiological measurements:

    • Measure oxygen consumption rates in wild Galago senegalensis across seasons and habitats

    • Quantify metabolic responses to temperature challenges

    • Monitor activity patterns in relation to environmental conditions

  • Molecular analyses:

    • Quantify MT-CO2 expression levels across different tissues and conditions

    • Assess MT-CO2 regulation under simulated environmental stressors using cell culture models

    • Investigate potential interaction with hypoxia-responsive elements like Higd1a, which is known to regulate cytochrome c oxidase activity

  • Functional validation:

    • Express variant forms of MT-CO2 and measure enzymatic activity

    • Create cellular models with Galago MT-CO2 variants to measure metabolic efficiency

This multifaceted approach would connect molecular variation in MT-CO2 to the observed physiological adaptations in Galago senegalensis, such as their possible heterothermic responses and energy conservation strategies in challenging environments .

How does selective pressure on MT-CO2 in Galago senegalensis compare to that in other primates?

The selective pressure on MT-CO2 in Galago senegalensis likely differs significantly from that in higher primates based on comparative studies of COII evolution across primates. Analysis should consider:

  • Ratio of nonsynonymous to synonymous substitutions (dN/dS):

    • Unlike higher primates which show accelerated rates of amino acid replacements in COII, lorisiforms like Galago senegalensis typically exhibit lower dN/dS ratios, suggesting stronger purifying selection

    • In contrast to the nearly two-fold increase in amino acid replacement rates seen in monkeys and apes, Galago senegalensis likely maintains a more conserved COII sequence

  • Site-specific selection analysis:

    • While the majority of codons in primate COII genes are under strong purifying selection (ω << 1), approximately 4% of sites may evolve under relaxed selective constraint (ω = 1) or positive selection

    • Key sites likely under different selective pressures include those at the cytochrome c binding interface, particularly positions 114-115 where higher primates show replacement of carboxyl-bearing residues

  • Coevolutionary constraints:

    • The MT-CO2 protein must maintain functional compatibility with nuclear-encoded subunits of the COX complex and with cytochrome c

    • This necessity for co-evolution may drive compensatory mutations when changes occur in interacting proteins

These patterns reflect the evolutionary history and ecological adaptations of Galago senegalensis, potentially relating to their nocturnal lifestyle, metabolic requirements, and environmental challenges.

What insights can be gained from comparing MT-CO2 variations across different Galago senegalensis populations?

Studying MT-CO2 variations across different Galago senegalensis populations can provide valuable insights into local adaptations, phylogeographic patterns, and potential functional divergence. Key approaches include:

  • Population genetic analysis:

    • Sequence MT-CO2 from individuals across the species' range, which spans diverse habitats in sub-Saharan Africa

    • Calculate population genetic parameters (nucleotide diversity, FST, haplotype diversity)

    • Test for signatures of selection across populations using statistical tests like Tajima's D and McDonald-Kreitman test

  • Correlation with ecological variables:

    • Similar to the approach seen in Tigriopus californicus where interpopulation divergence at the COII locus reached nearly 20% at the nucleotide level

    • Map sequence variations against environmental gradients (temperature, precipitation, altitude)

    • Examine whether nonsynonymous changes cluster in functional domains related to metabolic efficiency

  • Experimental validation:

    • Express population-specific variants in cellular models

    • Measure enzymatic efficiency under different conditions mimicking local environments

    • Test for functional compatibility with cytochrome c and other COX subunits from different populations

What strategies can overcome the challenges in expressing membrane-associated Galago senegalensis MT-CO2?

Expression of membrane-associated proteins like Galago senegalensis MT-CO2 presents significant technical challenges. The following strategies can improve success rates:

  • Fusion protein approaches:

    • N-terminal fusion with highly soluble partners (MBP, SUMO, or thioredoxin)

    • Addition of purification tags separated by TEV or PreScission protease cleavage sites

    • C-terminal fusions should be avoided as they may interfere with membrane insertion

  • Membrane mimetic systems:

    • Co-expression with other subunits of the cytochrome c oxidase complex

    • Inclusion of nanodiscs or amphipols during purification

    • Use of detergent screening to identify optimal solubilization conditions

  • Specialized expression hosts:

    • C41(DE3) or C43(DE3) E. coli strains engineered for membrane protein expression

    • Insect cells (Sf9 or Hi5) with baculovirus expression systems

    • Cell-free systems supplemented with microsomes or artificial membranes

  • Expression condition optimization:

    • Reduced temperature (16-20°C) during induction

    • Low inducer concentrations for slower expression

    • Addition of chemical chaperones to the growth medium

Implementation of these strategies should be guided by small-scale expression trials with subsequent optimization of conditions that show promise for producing functional protein.

What are the optimal methods for assessing the functional activity of recombinant Galago senegalensis MT-CO2?

Assessing the functional activity of recombinant Galago senegalensis MT-CO2 requires specialized approaches to evaluate its role in electron transfer and proton pumping. Recommended methods include:

  • Spectroscopic analysis:

    • Resonance Raman spectroscopy to evaluate the heme environment and confirm proper folding

    • Absorption spectroscopy to monitor redox state changes during electron transfer

    • Circular dichroism to assess secondary structure integrity

  • Oxygen consumption measurements:

    • Clark-type oxygen electrode assays using reconstituted proteoliposomes

    • High-resolution respirometry with isolated mitochondria or whole cells expressing the recombinant protein

    • Comparison of oxygen consumption rates between wild-type and mutant variants

  • Electron transfer kinetics:

    • Stopped-flow spectroscopy to measure electron transfer rates from cytochrome c

    • Flash photolysis to initiate and monitor rapid electron transfer events

    • Cross-species compatibility assays with cytochrome c from different primates

  • Proton pumping efficiency:

    • pH-sensitive fluorescent dyes to monitor proton translocation

    • Membrane potential measurements using voltage-sensitive probes

    • Direct measurement of ATP synthesis coupled to electron transport

These methods should be calibrated using well-characterized cytochrome c oxidase systems before application to the Galago senegalensis protein.

How can researchers investigate the interaction between Galago senegalensis MT-CO2 and regulatory factors like Higd1a?

To investigate the interaction between Galago senegalensis MT-CO2 and regulatory factors like Higd1a, researchers should employ a multi-faceted approach:

  • Co-immunoprecipitation and pull-down assays:

    • Express tagged versions of both proteins (separately and together)

    • Perform reciprocal pull-downs to confirm physical interaction

    • Use truncation mutants to map interaction domains

  • Functional modulation analysis:

    • Measure cytochrome c oxidase activity with and without Higd1a

    • Assess oxygen consumption rates in the presence of varying Higd1a concentrations

    • Evaluate ATP production efficiency under different conditions

  • Structural studies:

    • Employ crosslinking mass spectrometry to identify interaction interfaces

    • Perform molecular docking simulations based on available structures

    • If possible, obtain cryo-EM structures of the complex

  • Expression correlation studies:

    • Analyze co-expression patterns of MT-CO2 and Higd1a in Galago senegalensis tissues

    • Investigate expression responses under hypoxic conditions

    • Compare expression patterns with those in other primates

This approach would build on findings that Higd1a is transiently induced under hypoxic conditions and increases cytochrome c oxidase activity by directly interacting with the enzyme near its active center, leading to increased oxygen consumption and subsequent mitochondrial ATP synthesis .

What approaches can address inconsistent results in cross-species compatibility studies involving Galago senegalensis MT-CO2?

When encountering inconsistent results in cross-species compatibility studies with Galago senegalensis MT-CO2, consider these troubleshooting approaches:

  • Sample preparation standardization:

    • Implement rigorous quality control for protein purity (>95% by SDS-PAGE)

    • Verify protein folding through spectroscopic methods before experiments

    • Standardize buffer compositions and protein concentrations across experiments

  • Account for evolutionary divergence:

    • The poor enzyme kinetics observed in cross-reactions between cytochromes c and cytochrome c oxidases of higher primates and other mammals may explain variability

    • Design experiments that specifically test the hypothesis that amino acid replacements at positions 114 and 115 are responsible for incompatibility

    • Include multiple intermediate species to create an evolutionary gradient

  • Environmental variable control:

    • Systematically test different pH conditions (pH 6.8-7.4)

    • Evaluate the effect of ionic strength variations (50-200 mM)

    • Assess temperature sensitivity (25-39°C range)

  • Advanced analytical approaches:

    • Employ surface plasmon resonance to quantify binding kinetics under various conditions

    • Use hydrogen-deuterium exchange mass spectrometry to detect subtle conformational differences

    • Consider molecular dynamics simulations to predict interaction stability

A methodical investigation of these factors can help identify the source of inconsistency and develop more robust experimental protocols.

How can researchers differentiate between sequence variations that affect MT-CO2 function versus neutral polymorphisms?

Differentiating functional from neutral sequence variations in Galago senegalensis MT-CO2 requires an integrated approach:

  • Evolutionary conservation analysis:

    • Calculate site-specific evolutionary rates across primates

    • Identify sites under purifying selection (likely functional) versus those under neutral evolution

    • Pay particular attention to sites showing signatures of positive selection, which may indicate adaptive changes

  • Structural mapping:

    • Map variations onto protein structural models

    • Assess proximity to functional sites (electron transfer pathway, proton channels)

    • Evaluate changes in physicochemical properties (hydrophobicity, charge, size)

  • Experimental validation:

    • Create site-directed mutants for key variants

    • Measure electron transfer rates and oxygen consumption

    • Assess protein stability and assembly into the cytochrome c oxidase complex

  • Population genetic tests:

    • Apply McDonald-Kreitman tests to distinguish between adaptive and neutral mutations

    • Calculate the ratio of nonsynonymous to synonymous substitutions (dN/dS) at specific sites

    • Compare patterns of variation within and between populations

This approach would be similar to studies that identified that approximately 4% of the sites in the COII gene appear to evolve under relaxed selective constraint (ω = 1), while the majority are under strong purifying selection .

What emerging technologies could advance the study of Galago senegalensis MT-CO2 function in its native context?

Several emerging technologies hold promise for advancing our understanding of Galago senegalensis MT-CO2 function:

  • CRISPR-based approaches:

    • Development of Galago cell lines with tagged endogenous MT-CO2

    • Creation of specific MT-CO2 variants to test functional hypotheses

    • Inducible knockdown systems to study MT-CO2 deficiency effects

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize MT-CO2 distribution in mitochondria

    • Cryo-electron tomography to study the protein in its native membrane environment

    • FRET-based sensors to monitor MT-CO2 interactions in real-time

  • Metabolic phenotyping:

    • Comprehensive metabolomic profiling under various environmental conditions

    • Real-time monitoring of oxygen consumption in Galago senegalensis tissues

    • Integration with behavioral and physiological data from field studies

  • Single-cell approaches:

    • Single-cell transcriptomics to identify cell-type specific regulation

    • Spatial transcriptomics to map MT-CO2 expression across tissue regions

    • Integration with mitochondrial function assays at the single-cell level

These technologies could help address key knowledge gaps regarding how MT-CO2 contributes to the unique metabolic adaptations of Galago senegalensis to its ecological niche, particularly in relation to its potential thermoregulatory strategies and energy conservation mechanisms .

How might studying MT-CO2 in Galago senegalensis inform our understanding of primate evolution and adaptations?

Studying MT-CO2 in Galago senegalensis can provide unique insights into primate evolution and adaptation:

  • Evolutionary rate analysis:

    • Galago senegalensis represents an early-diverging primate lineage, making it valuable for understanding ancestral states

    • Comparing MT-CO2 evolution between Galago and other primates can illuminate when and why the acceleration in amino acid replacements occurred in higher primates

    • This may reveal selection pressures unique to different primate lineages

  • Metabolic adaptation mechanisms:

    • Investigation of how MT-CO2 contributes to Galago's capacity for nonshivering thermogenesis and potential heterothermic responses

    • Understanding the molecular basis of metabolic flexibility in small-bodied nocturnal primates

    • Correlation with behavioral and ecological adaptations observed in field studies

  • Coevolutionary dynamics:

    • Analysis of MT-CO2 evolution in relation to nuclear-encoded electron transport chain components

    • Investigation of potential compensation mechanisms for amino acid substitutions

    • Understanding the molecular constraints on mitochondrial-nuclear coevolution

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.