Recombinant Galago senegalensis Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Galago senegalensis (Northern lesser bushbaby) (Senegal bushbaby)
Target Names
Target Protein Sequence
MPAQGSQRSXLGSLNSTLMATPSLGLAANQSGPQCLEVSVPDGLFLCLGLVSLVENMLVV AAIAKNRNLHSPMYCFICCLALSDLLVSISNVLETAVMLLLEAGALAVGATVVQQLDNVI DVLICSSMVSSLCFLGAIAMDRYISIFYALRYHSIVTLSRAQWATAAVWAASILSSTLFI AYYDRTVVLLCLVVFFLAMLVLMAVLYAHMLTQACQHVQGITRLHKRQHLVQQGFGLKGA ATLTILLGVFLLCWGPFFLHLTLIAVCPQHPTCSCVFKNFKLFLALIICNAIVDPLIYAF RSQELRKTLKEVLLFSW
Uniprot No.

Target Background

Function
This receptor binds to alpha, beta, and gamma melanocyte-stimulating hormone (MSH) and adrenocorticotropic hormone (ACTH). Its activity is mediated by G proteins that activate adenylate cyclase. This receptor regulates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by controlling cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does MC1R structure in Galago senegalensis compare to other primates?

The MC1R protein in Galago senegalensis belongs to the G protein-coupled receptor family, preserving the characteristic seven-transmembrane domain structure found across primates. Sequence analysis reveals that in primates, MC1R is generally under purifying selection (ω = 0.0912 in Lorisidae), indicating evolutionary conservation of its function .

Unlike some primates with dramatic color variations, the MC1R in Galago senegalensis appears highly conserved, reflecting its nocturnal lifestyle where selective pressures on coat coloration may differ from diurnal primates. Studies on MC1R in nonhuman primates have found that nonsynonymous mutations are not typically correlated with coat color variations but instead appear influenced primarily by phylogenetic relationships .

What is the evolutionary significance of MC1R in the Lorisidae family?

The MC1R gene in Lorisidae (including Galago senegalensis) demonstrates evidence of purifying selection consistent with other nocturnal primates. This suggests critical functional conservation despite varying coat patterns among Lorisidae members. The evolutionary analysis indicates:

This conservation does not mean MC1R lacks functional importance in coat morphology, but rather suggests changes in the gene significantly impact survival, possibly through pleiotropic effects beyond pigmentation.

What are optimal storage and handling conditions for recombinant Galago senegalensis MC1R?

For optimal stability and activity of recombinant Galago senegalensis MC1R, researchers should follow these evidence-based protocols:

  • Store stock protein at -20°C in Tris-based buffer with 50% glycerol

  • For extended storage, maintain at -80°C

  • Avoid repeated freeze-thaw cycles; prepare working aliquots

  • Working aliquots remain stable at 4°C for approximately one week

For experimental applications, the recombinant protein typically maintains activity when stored in appropriate conditions, but researchers should conduct activity validation assays when using stored protein for functional studies.

What methods are most effective for analyzing MC1R polymorphisms in primate species?

Based on successful approaches in primate MC1R research, the following methodological framework is recommended:

DNA Extraction and Amplification:

  • For captive/laboratory specimens: Standard blood or tissue DNA extraction procedures

  • For wild populations: Non-invasive sampling techniques from hair or fecal samples, as demonstrated in recent galago research

Polymorphism Analysis:

  • PCR-RFLP (Polymerase Chain Reaction-Restriction Fragment Length Polymorphism) using appropriate restriction enzymes as demonstrated in other mammalian MC1R studies

  • Direct sequencing of the complete MC1R coding region

  • Comparative analysis of synonymous and nonsynonymous substitutions to determine selection signatures

Data Analysis:

  • Calculate dN/dS ratios to assess selection pressures

  • Compare sequence variations to established phenotypic traits

  • Phylogenetic analysis to distinguish selection from genetic drift

Researchers should note that successful MC1R analysis in other primate studies has revealed purifying selection is the predominant evolutionary mode in nonhuman primates, with specific exceptions like the golden lion tamarin .

How can MC1R function be assessed in Galago senegalensis cell models?

Functional assessment of MC1R in Galago senegalensis cell models requires specialized approaches tailored to this nocturnal primate:

Cell Culture Systems:

  • Primary melanocyte cultures from Galago tissue (when ethically available)

  • Heterologous expression systems using mammalian cells (HEK293, COS-7) transfected with Galago MC1R constructs

Functional Assays:

  • cAMP accumulation assays to measure MC1R signaling activity

  • Melanin synthesis quantification in melanocyte models

  • Binding assays with labeled α-MSH or other MC1R ligands

  • Calcium mobilization assays for downstream signaling

Comparative Analysis:

  • Side-by-side comparison with human MC1R variants to identify functional divergence

  • Mutagenesis studies targeting conserved and non-conserved residues

  • Response curves to varied ligand concentrations to determine sensitivity differences

Given MC1R's demonstrated role in pain sensitivity modulation in other species, researchers might also consider neuronal cell models to investigate potential non-pigmentary functions in Galago senegalensis .

What patterns of MC1R polymorphism occur in primates compared to other mammals?

Primate MC1R polymorphism patterns show distinct characteristics compared to other mammals:

Primate MC1R Polymorphism Patterns:

  • Nonhuman primates generally show purifying selection on MC1R

  • Polymorphisms in primates are more often correlated with phylogeny than with coat color variation

  • Notable exception: Golden lion tamarin (Leontopithecus rosalia) shows higher dN/dS ratio (0.91) with functionally important substitutions potentially related to its red coat

Other Mammals (Comparative):

  • Rock pocket mice (Chaetodipus intermedius): MC1R amino acid changes directly linked to adaptive coloration for camouflage in different environments

  • Domestic cattle: MC1R polymorphisms strongly correlate with coat color phenotypes

  • South American camelids: Nineteen polymorphisms identified in the MC1R gene, with seven significantly associated with coat color variation

Key Differences:

  • Adaptive coloration in mammals like mice shows direct MC1R genotype-phenotype correlation

  • Primate coloration appears more complex, with MC1R playing a conserved role but not always the primary determinant of coat color

  • Domesticated mammals show stronger MC1R-coat color associations than wild primates

This suggests that while MC1R is critical for mammalian pigmentation broadly, its specific role and patterns of variation differ substantially between primates and other mammalian lineages.

How might MC1R function relate to the nocturnal ecology of Galago senegalensis?

The relationship between MC1R function and nocturnal ecology in Galago senegalensis represents an underexplored research avenue with several plausible connections:

Coat Coloration and Predator Avoidance:

  • Galago senegalensis occupies various habitats across sub-Saharan Africa

  • Nocturnal primates typically have less dramatic coat color variation than diurnal counterparts

  • MC1R conservation may support optimal camouflage for predator avoidance during daytime sleeping periods

  • Northern lesser galagos select sleeping sites that allow them to remain hidden from predators while maintaining escape routes

Visual Ecology and Communication:

  • Nocturnal vision relies less on color discrimination than diurnal vision

  • MC1R-mediated coat coloration may be under different selective pressures in nocturnal species

  • Social communication in Galago senegalensis relies heavily on olfactory and vocal signals rather than visual cues

Thermoregulation:

  • MC1R's role in pigmentation affects heat absorption

  • Galagos must remain cool when sleeping during daytime

  • MC1R variants could potentially influence thermal adaptation

These connections suggest that MC1R function in Galago senegalensis should be studied within the broader context of its ecological adaptations to nocturnal life, rather than focusing solely on pigmentation outcomes.

What role might MC1R play in pain sensitivity modulation in Galago senegalensis?

Based on MC1R studies in other species, researchers investigating pain sensitivity in Galago senegalensis should consider these methodological approaches:

Background Context:

  • Human MC1R variants affect pain sensitivity, with evidence that redheads have increased sensitivity to thermal pain and different responses to anesthetics and analgesics

  • MC1R variant carriers show differences in response to the opioid pain medication pentazocine

  • The mechanism appears to involve both central and peripheral pain processing pathways

Research Approaches for Galago Models:

  • Behavioral Assays: Modified pain sensitivity tests appropriate for nocturnal primates

  • Pharmacological Studies: Comparative responses to analgesics and anesthetics

  • Molecular Mechanisms: Investigation of α-MSH and MC1R interactions in nociceptive neurons

  • Comparative Genomics: Analysis of MC1R sequence variants in relation to conserved pain modulation domains

Methodological Challenges:

  • Ethical considerations for pain studies in primates require careful refinement

  • Galago-specific behavioral indicators of pain need validation

  • Translation of findings between nocturnal and diurnal primates requires caution

This research direction could provide valuable insights into the evolution of pain processing across primates and potential therapeutic targets for pain management.

How might MC1R variants in Galago senegalensis influence susceptibility to disease?

Research on MC1R variants in humans suggests potential areas for investigation regarding disease susceptibility in Galago senegalensis:

Parkinson's Disease Relevance:

  • Human MC1R variants are associated with increased Parkinson's disease risk

  • Mouse models with loss-of-function MC1R variants show increased susceptibility to dopaminergic toxins

  • MC1R may have a neuroprotective role in dopaminergic pathways

Research Approaches:

  • Sequencing MC1R in Galago populations to identify functional variants

  • Analysis of MC1R expression in brain tissue, particularly in dopaminergic regions

  • Development of cellular models expressing Galago MC1R variants to test neuroprotective functions

  • Comparative histopathological examination of aged specimens with different MC1R genotypes

Methodological Considerations:

  • Galago models may provide evolutionary insight into MC1R's role in neurodegeneration

  • The nocturnal, arboreal lifestyle of galagos may impose different selective pressures on neurological pathways

  • Ethical considerations require development of minimally invasive approaches for studying wild populations

This research direction could illuminate the evolutionary history of MC1R's non-pigmentary functions and potentially identify novel neuroprotective mechanisms.

What techniques can be used to study MC1R expression patterns in Galago senegalensis tissues?

Researchers investigating MC1R expression patterns in Galago senegalensis should consider this multi-method approach:

Tissue Collection Approaches:

  • Post-mortem collection from ethically sourced specimens (natural deaths in captivity)

  • Minimally invasive biopsy techniques for skin samples from living subjects

  • Bank tissue samples from veterinary procedures conducted for animal health

Expression Analysis Methods:

  • RT-qPCR: Quantitative analysis of MC1R transcript levels across tissues

  • RNAscope: In situ hybridization for precise cellular localization of MC1R mRNA

  • Immunohistochemistry: Protein-level detection using validated MC1R antibodies

  • Single-cell RNA sequencing: For cell-type specific expression profiles

Comparative Framework:

  • Compare expression patterns with those in diurnal primates

  • Correlate expression with functional traits (pigmentation, neurological function)

  • Analyze expression in relation to circadian rhythms given nocturnal lifestyle

Technical Considerations:

This systematic approach would provide crucial baseline data on MC1R expression that could inform functional studies and comparative analyses across primate lineages.

What experimental controls are essential when studying recombinant Galago senegalensis MC1R?

Researchers working with recombinant Galago senegalensis MC1R should implement these essential controls:

Protein Quality Controls:

  • SDS-PAGE with Coomassie staining to confirm protein purity

  • Western blot with anti-MC1R antibodies to verify identity

  • Mass spectrometry to confirm sequence integrity

  • Circular dichroism to assess proper protein folding

Functional Validation Controls:

  • Positive control: Human MC1R with well-characterized activity

  • Negative control: Inactive MC1R mutant or vector-only expression

  • Dose-response curves to confirm receptor pharmacology

  • Competition binding assays to verify ligand specificity

Expression System Controls:

  • Mock-transfected cells to control for endogenous activities

  • Multiple expression systems to confirm consistent protein behavior

  • Time-course expression analysis to determine optimal harvesting time

  • Different tag positions to assess potential interference with function

Storage Stability Controls:

  • Activity assays before and after storage at recommended conditions

  • Comparison of fresh vs. frozen protein activity

  • Assessment of protein activity after multiple freeze-thaw cycles

Implementing these controls ensures that experimental observations can be reliably attributed to the recombinant Galago senegalensis MC1R rather than to artifacts or contamination.

What ethical considerations apply to research on MC1R in wild Galago senegalensis populations?

Researchers studying MC1R in wild Galago senegalensis populations must address these ethical considerations:

Sample Collection Ethics:

  • Prioritize non-invasive sampling methods (fecal samples, hair samples, etc.)

  • Minimize disruption to natural behaviors, particularly during vulnerable periods

  • Obtain appropriate permits and permissions from relevant wildlife authorities

  • Implement protocols that avoid stress or harm to individual galagos

Research Justification:

  • Clearly define research questions with potential conservation benefits

  • Balance scientific knowledge gain against potential negative impacts

  • Consider whether existing samples or data could answer the research question

  • Ensure sample sizes are statistically valid but not excessive

Habitat and Population Considerations:

  • Evaluate potential impacts on local galago populations before initiating field work

  • Implement strict biosecurity to prevent disease transmission

  • Minimize habitat disturbance during nocturnal observations

  • Consider seasonal timing to avoid reproductive periods if appropriate

Alternatives and Refinements:

  • Use computational modeling when possible to reduce field sampling needs

  • Develop and validate minimally invasive techniques appropriate for nocturnal primates

  • Establish tissue/DNA banking to maximize research output from each sample

  • Share data openly to reduce redundant sampling across research groups

Recent advances in non-invasive genetic sampling methods for galagids offer promising alternatives to traditional capture methods, allowing researchers to obtain DNA samples with minimal disturbance to wild populations .

What methodological challenges exist in translating MC1R findings between different primate species?

Researchers face several methodological challenges when translating MC1R findings between Galago senegalensis and other primates:

Evolutionary Distance Considerations:

  • Galago senegalensis belongs to Lorisidae within Strepsirrhini, evolutionarily distant from Haplorrhini (which includes apes and humans)

  • MC1R functions may have diverged significantly despite sequence similarities

  • Selection pressures differ between nocturnal and diurnal primates

Physiological Context Differences:

  • Nocturnal vs. diurnal lifestyle affects pigmentation requirements

  • Different predator pressures influence selection on camouflage

  • Thermal regulation needs differ across primate habitats

Technical Challenges:

  • Limited availability of Galago-specific reagents and antibodies

  • Cross-reactivity issues in molecular and immunological assays

  • Different cell culture requirements for tissue-derived cells

Analytical Approaches to Address Challenges:

  • Employ phylogenetically aware statistical methods that account for evolutionary relationships

  • Develop species-specific functional assays rather than relying on standardized human-oriented protocols

  • Use comparative genomics to identify conserved vs. diverged functional domains

  • Implement systematic validation of reagents and methods across species

Recommended Validation Strategy:

  • Establish clear orthology of MC1R genes between species

  • Confirm similar protein expression patterns in relevant tissues

  • Verify functional conservation through comparative biochemical assays

  • Validate phenotypic effects in appropriate model systems

By systematically addressing these challenges, researchers can develop more robust translational approaches that account for the unique evolutionary context of Galago senegalensis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.