Recombinant Galago senegalensis NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Expression System

  • Host: Cell-free expression system

  • Tag: Epitope tag determined during manufacturing (commonly His-tag for affinity purification)

  • Purity: >85% confirmed by SDS-PAGE

Formulation

  • Storage Buffer: Tris-based buffer with 50% glycerol (pH optimized for stability)

  • Lyophilization: Available in lyophilized powder form; reconstitution in deionized water recommended

Stability Metrics

ConditionStability Duration
-80°C (lyophilized)12 months
-20°C (liquid)6 months
4°C (working aliquot)1 week

Functional Role in Mitochondrial Complex I

As a core subunit of NADH dehydrogenase, recombinant Galago MT-ND4L enables:

  • Electron Transfer: Mediates electron flow from NADH to ubiquinone during oxidative phosphorylation

  • Proton Pumping: Contributes to the transmembrane proton gradient essential for ATP synthesis

  • Pathological Relevance: Mutations in homologous human MT-ND4L disrupt Complex I assembly, linking to Leber’s hereditary optic neuropathy (LHON) and metabolic disorders

Research Applications

Experimental Use Cases

  • Enzyme Kinetics: Used to study species-specific differences in Complex I activity

  • Structural Biology: Facilitates cryo-EM studies of mitochondrial membrane protein complexes

  • Drug Screening: Target for inhibitors in metabolic disease research

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us and we will prioritize its implementation.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Galago senegalensis (Northern lesser bushbaby) (Senegal bushbaby)
Target Names
Target Protein Sequence
MPSISTNIILAFTTALLGVLIYRSHLMSSLLCLEGMMLSMFILVSLTTLNLHFSLATVTP IILLVFAACEAAVGLALLVMVSNTYGMDYIQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its role in mitochondrial function?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a small but critical component of mitochondrial Complex I, which represents the first enzyme in the electron transport chain during oxidative phosphorylation. This highly hydrophobic protein functions as part of the membrane-embedded domain of Complex I that contributes to proton translocation across the inner mitochondrial membrane. Specifically, MT-ND4L participates in the first step of electron transfer from NADH to ubiquinone, helping to establish the electrochemical gradient required for ATP production. The protein contains 98 amino acids in Galago senegalensis and is characterized by multiple transmembrane domains that anchor it within the inner mitochondrial membrane. Understanding MT-ND4L's structure-function relationship is essential for elucidating the molecular mechanisms of oxidative phosphorylation and cellular energy production .

What is the amino acid sequence and structural characteristics of Galago senegalensis MT-ND4L?

The amino acid sequence of Galago senegalensis MT-ND4L consists of 98 amino acids (expression region 1-98) with the sequence: MPSISTNIILAFTALLGVLIYRSHLLSLLCLEGMMLSMFILVSLTTLNLHFSLATVTPIILLVFAACEAAVGLALLVMVSNTYGMDYIQNLNLLQC. This protein is characterized by its high hydrophobicity, which reflects its role as a membrane-embedded component of Complex I. The structure includes multiple transmembrane helices that traverse the inner mitochondrial membrane. Compared to MT-ND4L proteins in other species, the Galago senegalensis variant maintains the conserved regions necessary for proper integration into Complex I, while displaying species-specific variations that may reflect evolutionary adaptations. The protein's hydrophobic nature presents significant challenges for structural studies, requiring specialized techniques for purification and analysis .

How does MT-ND4L contribute to Complex I assembly and activity?

MT-ND4L plays a crucial role in both the assembly and functional activity of mitochondrial Complex I. Research using RNA interference to suppress gene expression in model organisms has demonstrated that the absence of ND4L prevents the assembly of the complete 950-kDa Complex I structure and completely suppresses enzyme activity. This suggests that MT-ND4L is not merely a structural component but is essential for the correct assembly and stability of the entire complex. The highly hydrophobic nature of MT-ND4L indicates it likely contributes to the membrane-embedded arm of Complex I, providing structural elements necessary for proton translocation. The proper integration of MT-ND4L is required for the sequential assembly of other Complex I subunits, making it a key factor in the biogenesis pathway of this crucial respiratory enzyme .

What are the optimal methods for expressing and purifying recombinant Galago senegalensis MT-ND4L for structural studies?

The expression and purification of highly hydrophobic membrane proteins like MT-ND4L present significant technical challenges. For recombinant expression, bacterial systems are often suboptimal due to the protein's hydrophobicity and potential toxicity. Instead, researchers should consider:

  • Expression System Selection: Eukaryotic expression systems such as yeast (Pichia pastoris) or insect cells (using baculovirus) generally provide better results for mitochondrial membrane proteins. These systems offer appropriate chaperones and membrane insertion machinery.

  • Solubilization Strategy: Effective solubilization requires careful detergent selection. A systematic screen of detergents including DDM (n-dodecyl-β-D-maltoside), LMNG (lauryl maltose neopentyl glycol), and amphipols is recommended. For MT-ND4L specifically, mild detergents that preserve native structure should be prioritized.

  • Purification Approach: A multi-step purification strategy is essential, typically involving:

    • Affinity chromatography (using a well-positioned tag that doesn't interfere with protein folding)

    • Size exclusion chromatography

    • Ion exchange chromatography if needed

  • Stability Assessment: Thermal shift assays and limited proteolysis can help identify optimal buffer conditions that maintain protein stability throughout purification.

The recombinant protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended periods to maintain structural integrity and prevent aggregation .

What techniques are most effective for studying interactions between MT-ND4L and other Complex I subunits?

Investigating the interactions between MT-ND4L and other Complex I subunits requires specialized approaches due to the complex's membrane-embedded nature. The most effective techniques include:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This technique enables the separation of intact protein complexes and subcomplexes while preserving protein-protein interactions. BN-PAGE combined with NADH/NBT staining can identify functional Complex I assemblies and detect assembly defects when MT-ND4L is absent or modified.

  • Crosslinking Mass Spectrometry (XL-MS): Chemical crosslinking coupled with mass spectrometry can identify direct interaction partners of MT-ND4L within the complex. This provides spatial constraints that reveal the protein's position relative to other subunits.

  • Co-immunoprecipitation with Antibodies: Using antibodies against either MT-ND4L or potential interaction partners can pull down associated proteins for identification. This can be challenging due to the hydrophobic nature of the proteins but can be optimized with appropriate detergents.

  • Proximity Labeling: Techniques such as BioID or APEX2 proximity labeling, where MT-ND4L is fused to an enzyme that biotinylates nearby proteins, can map the protein's interaction neighborhood within the complex.

  • Cryo-EM Analysis: When combined with biochemical approaches, cryo-electron microscopy of purified Complex I can reveal the structural integration of MT-ND4L and its interfaces with neighboring subunits.

Each of these methods provides complementary information, and their combined application offers the most comprehensive understanding of MT-ND4L's interactions within Complex I .

How can researchers effectively measure the functional impact of MT-ND4L mutations on Complex I activity?

To systematically assess the functional consequences of MT-ND4L mutations, researchers should implement a multi-faceted approach that evaluates both biochemical activity and structural integrity:

  • Site-Directed Mutagenesis: Generate specific mutations in recombinant expression systems or, where possible, introduce mutations into model organisms. The T10663C (Val65Ala) mutation identified in Leber hereditary optic neuropathy patients provides a starting point for pathogenic variants to study.

  • Enzymatic Activity Assays:

    • NADH:ubiquinone oxidoreductase activity assay using artificial electron acceptors

    • Oxygen consumption measurements in isolated mitochondria or whole cells

    • ROS production quantification to assess electron leakage

  • Assembly Analysis:

    • Blue Native PAGE followed by Western blotting using antibodies against various Complex I subunits

    • Sucrose gradient ultracentrifugation to separate and identify subcomplexes

  • Membrane Potential Measurements:

    • JC-1 or TMRM fluorescent dyes to assess mitochondrial membrane potential

    • Patch-clamp techniques for direct measurement of proton translocation

  • Structural Analysis:

    • Hydrogen-deuterium exchange mass spectrometry to detect conformational changes

    • Cryo-EM to visualize structural perturbations in the assembled complex

  • Cellular Phenotyping:

    • ATP production measurement

    • Cell viability and growth rate assessment

    • Mitochondrial network morphology visualization

When interpreting results, researchers should consider that mutations might impact different aspects of MT-ND4L function, including complex assembly, catalytic activity, proton pumping, or ROS production. Comprehensive characterization requires assessing all these parameters .

How does nuclear-encoded MT-ND4L in some species differ from mitochondrially-encoded versions in structure and function?

The genomic relocation of the MT-ND4L gene from the mitochondrial to the nuclear genome in certain species represents a fascinating case of evolutionary adaptation. This relocation necessitates significant molecular changes to ensure proper expression, targeting, and functionality:

  • Sequence Adaptations: Nuclear-encoded MT-ND4L proteins (such as those in Chlamydomonas reinhardtii) typically display reduced hydrophobicity compared to their mitochondrially-encoded counterparts. This adaptation facilitates the protein's translation in the cytosol and subsequent import into mitochondria. Specifically, the transmembrane domains often contain more polar residues while maintaining the core structural elements necessary for function.

  • Codon Usage Optimization: The transfer to the nuclear genome is accompanied by shifts in codon usage patterns, transitioning from mitochondrial to nuclear preferences. This optimization ensures efficient translation in the cytosolic environment.

  • Acquisition of Targeting Sequences: Nuclear-encoded MT-ND4L requires the addition of mitochondrial targeting sequences that direct the protein to its proper subcellular location. These N-terminal extensions are cleaved upon import into the mitochondria.

  • Intron Acquisition: Many nuclear-encoded homologs have acquired introns absent in mitochondrial genes. For example, the NUO11 gene (nuclear MT-ND4L homolog) in Chlamydomonas contains a 90-bp intron.

  • Functional Consequences: Despite these significant changes, nuclear-encoded MT-ND4L proteins maintain their essential role in Complex I assembly and function. RNA interference experiments have demonstrated that suppression of nuclear MT-ND4L expression prevents Complex I assembly, indicating functional equivalence to mitochondrially-encoded versions.

These adaptations illustrate the remarkable plasticity of the mitochondrial respiratory system during evolution while maintaining the critical functions necessary for cellular energy production .

What evolutionary insights can be gained from studying MT-ND4L across different primate species, including Galago senegalensis?

Comparative analysis of MT-ND4L across primate species, including Galago senegalensis (Northern lesser bushbaby), provides valuable insights into mitochondrial evolution, selection pressures, and functional constraints:

These evolutionary analyses not only contribute to our understanding of primate phylogeny but also provide insights into the fundamental structural and functional constraints on this essential component of mitochondrial energy production .

How do mutations in MT-ND4L contribute to Leber hereditary optic neuropathy, and what experimental models best capture this pathology?

Mutations in MT-ND4L, particularly the T10663C (Val65Ala) variant, have been identified in several families with Leber hereditary optic neuropathy (LHON), a mitochondrial disorder characterized by sudden vision loss due to retinal ganglion cell degeneration. The pathogenic mechanisms and optimal experimental models include:

  • Pathogenic Mechanisms:

    • Bioenergetic Deficiency: MT-ND4L mutations likely reduce Complex I activity, compromising ATP production in the highly energy-dependent retinal ganglion cells.

    • Increased ROS Production: Dysfunctional Complex I can leak electrons, generating excessive reactive oxygen species that damage retinal neurons.

    • Disturbed Assembly: The Val65Ala mutation may destabilize protein folding or interfere with the assembly of the complete Complex I structure.

    • Tissue Specificity: The mutation's effects are most pronounced in retinal ganglion cells due to their high energy demands and limited regenerative capacity.

  • Experimental Models:

    • Cybrid Cell Lines: Transmitochondrial cytoplasmic hybrid cells containing patient-derived mitochondria with MT-ND4L mutations provide a controlled system to study cellular consequences.

    • iPSC-Derived Retinal Ganglion Cells: Patient-specific induced pluripotent stem cells differentiated into retinal ganglion cells capture both the genetic background and the relevant cell type.

    • CRISPR-Engineered Cell Lines: Precise introduction of the T10663C mutation in cells using CRISPR/Cas9 allows direct comparison with isogenic controls.

    • Mouse Models: While challenging due to mitochondrial genetics, mice carrying human LHON mutations can model systemic aspects of the disease.

    • Drosophila Models: Fruit flies engineered to express mutant MT-ND4L in their visual system offer advantages for high-throughput screening.

  • Experimental Readouts:

    • Complex I activity and assembly measurements

    • Mitochondrial membrane potential assessment

    • ATP production quantification

    • ROS levels and oxidative damage markers

    • Cell death assays specific to retinal ganglion cells

    • Visual function tests in animal models

Understanding how MT-ND4L mutations lead to LHON pathology requires integrating data from these complementary model systems, with particular attention to the unique vulnerabilities of retinal ganglion cells .

What methodological approaches can researchers use to investigate potential therapeutic strategies targeting MT-ND4L dysfunction?

Investigating therapeutic approaches for MT-ND4L dysfunction requires methodical strategies that address the multiple consequences of Complex I deficiency. Researchers should consider the following methodological approaches:

These methodological approaches should be applied systematically, with careful attention to controls and rigorous statistical analysis to identify truly effective therapeutic strategies for MT-ND4L dysfunction .

What are the key considerations for designing RNA interference experiments to study MT-ND4L function, similar to those performed in Chlamydomonas?

Designing effective RNA interference (RNAi) experiments to study MT-ND4L function requires careful consideration of multiple factors to ensure specific knockdown with minimal off-target effects. Based on successful approaches in Chlamydomonas and other systems, researchers should address the following key considerations:

  • Target Sequence Selection:

    • Identify regions of high specificity within the MT-ND4L transcript to minimize off-target effects

    • Choose sequences with appropriate GC content (30-60%) for optimal RNAi efficiency

    • Avoid targeting sequences shared with other genes, particularly other Complex I components

    • Consider targeting both exonic regions and, where applicable, intronic sequences for enhanced knockdown

  • RNAi Construct Design:

    • For hairpin RNAi approaches, design constructs with:

      • Sense and antisense fragments of 400-600 bp for optimal processing

      • A spacer sequence of 90-100 bp to facilitate hairpin formation

      • Appropriate restriction sites for cloning (e.g., HindIII, NcoI, ClaI sites)

    • Include a selectable marker gene (such as ARG7) for identifying transformants

  • Delivery Method Optimization:

    • For Chlamydomonas and similar organisms, the glass bead transformation method with 5 μg of linearized plasmid has proven effective

    • For mammalian cells, consider viral vectors or lipid-based transfection methods

    • Optimize transformation conditions for each specific cell type or organism

  • Validation Strategy:

    • Confirm knockdown efficiency using RNA blot analysis with specific probes

    • Verify reduction in protein levels using Western blotting where antibodies are available

    • Include multiple control genes (e.g., NUO9, NUO7) to confirm specificity of knockdown

  • Phenotypic Analysis:

    • Assess Complex I assembly using Blue Native PAGE with both activity staining (NADH/NBT) and protein staining (Coomassie blue)

    • Measure complex activity using standard biochemical assays

    • Evaluate cellular consequences through growth assessment, respiration measurements, and ROS production

  • Controls and Comparisons:

    • Include non-targeting RNAi constructs as negative controls

    • Compare knockdown effects with known mutants affecting other Complex I components

    • Consider partial knockdown strategies to identify dose-dependent effects

By following these methodological guidelines, researchers can effectively implement RNAi approaches to study MT-ND4L function across different biological systems .

What analytical approaches best characterize the impact of MT-ND4L absence on Complex I assembly intermediates?

Characterizing Complex I assembly intermediates when MT-ND4L is absent requires sophisticated analytical approaches that can resolve dynamic subcomplexes and provide insights into the assembly pathway. Based on established methodologies in mitochondrial research, the following analytical approaches are most effective:

  • Two-Dimensional Blue Native/SDS-PAGE Analysis:

    • First dimension: Separate intact complexes and subcomplexes using gradient (4-12%) BN-PAGE

    • Second dimension: Resolve individual proteins via SDS-PAGE

    • Visualization: Western blotting with antibodies against multiple Complex I subunits from different modules

    • This approach reveals accumulation patterns of specific subcomplexes indicative of assembly blockade points

  • Sucrose Gradient Ultracentrifugation:

    • Separate subcomplexes based on size and density through 10-30% sucrose gradients

    • Collect fractions and analyze by Western blotting or mass spectrometry

    • Compare sedimentation profiles between wild-type and MT-ND4L-deficient samples to identify shifts in assembly intermediates

  • Pulse-Chase Analysis of Assembly Kinetics:

    • Label newly synthesized mitochondrial proteins with radioactive amino acids

    • Chase for various time periods to track incorporation into assembly intermediates

    • Visualize using BN-PAGE followed by autoradiography or phosphorimaging

    • This approach provides temporal information about assembly progression

  • Quantitative Proteomics of Purified Mitochondria:

    • Use SILAC, TMT, or label-free quantification to compare protein abundance

    • Focus on changes in stoichiometry among Complex I subunits

    • Identify compensatory changes in other respiratory complexes

    • Apply pathway analysis to reveal broader mitochondrial adaptations

  • Cryo-EM Analysis of Purified Subcomplexes:

    • Isolate prevalent assembly intermediates using immunoprecipitation

    • Determine structures via cryo-electron microscopy

    • Compare with known structures of fully assembled Complex I to identify missing or altered regions

  • In-Gel Activity Assays of Assembly Intermediates:

    • Separate complexes using BN-PAGE under mild conditions

    • Perform in-gel NADH dehydrogenase activity staining

    • Assess which assembly intermediates retain partial activity

    • Compare activity patterns between wild-type and MT-ND4L-deficient samples

These complementary approaches provide a comprehensive view of how MT-ND4L absence affects the step-wise assembly process of Complex I, identifying specific blockade points and potential assembly branch points .

How does the hydrophobicity profile of MT-ND4L compare across species, and what methodological approaches best analyze these differences?

The hydrophobicity profile of MT-ND4L shows significant variations across species, particularly between mitochondrially-encoded and nuclear-encoded variants. These differences reflect evolutionary adaptations to different genetic environments and import requirements. The following methodological approaches are most effective for analyzing these variations:

  • Computational Hydrophobicity Analysis:

    • Apply multiple hydrophobicity scales (Kyte-Doolittle, Eisenberg, HMMTOP) to detect subtle differences

    • Calculate transmembrane probability plots using prediction algorithms like TMHMM, Phobius, and TOPCONS

    • Compare average hydrophobicity scores across full sequences and specific domains

    • Generate sliding window analysis (window size 19-21 residues) to identify localized hydrophobicity changes

  • Experimental Membrane Integration Assessment:

    • Employ in vitro translation systems with microsomal membranes to quantify membrane integration efficiency

    • Use protease protection assays to determine transmembrane topology

    • Apply glycosylation mapping to identify lumenal loops

    • Compare integration patterns between species variants using these biochemical approaches

  • Fluorescence-Based Techniques:

    • Incorporate environment-sensitive fluorescent probes at specific positions

    • Measure changes in fluorescence properties as indicators of membrane environment

    • Compare quenching patterns between different species variants

  • Comparative Structural Analysis:

    • Generate homology models based on available Complex I structures

    • Map hydrophobicity differences onto these structural models

    • Analyze how variations affect interactions with neighboring subunits

    • Predict functional consequences of hydrophobicity changes at key interfaces

  • Hybrid Protein Analysis:

    • Create chimeric proteins combining regions from mitochondrially-encoded and nuclear-encoded variants

    • Assess membrane integration, complex assembly, and functional activity

    • Identify critical domains where hydrophobicity differences impact function

The data from these approaches can be organized into comparative tables that highlight:

  • Transmembrane domain count and position across species

  • Average hydrophobicity scores for each domain

  • Conservation of charged residues within hydrophobic regions

  • Correlation between hydrophobicity changes and genomic location (mitochondrial vs. nuclear)

These analyses reveal how evolutionary pressures have shaped MT-ND4L structure while maintaining its essential function in Complex I across diverse species .

How can researchers effectively determine the precise role of MT-ND4L in proton translocation during Complex I activity?

Determining the precise role of MT-ND4L in proton translocation represents one of the most challenging aspects of Complex I research. This requires sophisticated methodological approaches that combine structural, biochemical, and biophysical techniques:

  • Site-Directed Mutagenesis of Key Residues:

    • Identify conserved charged residues within or adjacent to transmembrane domains

    • Generate systematic substitutions (conservative and non-conservative)

    • Assess effects on proton pumping efficiency and electron transfer activity

    • Create a comprehensive structure-function map correlating specific residues with proton translocation

  • Reconstitution Studies with Purified Components:

    • Reconstitute purified MT-ND4L (wild-type and mutants) into liposomes

    • Measure proton translocation using pH-sensitive fluorescent dyes

    • Assess coupling efficiency between electron transfer and proton pumping

    • Compare results between reconstituted systems and intact Complex I

  • Advanced Biophysical Measurements:

    • Apply solid-state NMR to detect conformational changes during catalysis

    • Use neutron scattering with deuterium labeling to track proton movements

    • Employ time-resolved FTIR spectroscopy to monitor protonation state changes

    • Implement single-molecule FRET to detect conformational dynamics during catalysis

  • Computational Molecular Dynamics:

    • Perform all-atom molecular dynamics simulations of MT-ND4L within membrane environments

    • Model proton transfer pathways and energy barriers

    • Calculate pKa values of potential proton-carrying residues

    • Simulate conformational changes coupled to redox reactions

  • Crosslinking and Accessibility Studies:

    • Use state-dependent crosslinking to capture different conformational states

    • Implement cysteine scanning mutagenesis combined with accessibility measurements

    • Map movement of specific MT-ND4L domains during the catalytic cycle

    • Correlate structural rearrangements with proton translocation events

  • Electrophysiological Approaches:

    • Apply patch-clamp techniques to submitochondrial particles or reconstituted systems

    • Measure proton currents associated with Complex I activity

    • Assess how MT-ND4L mutations alter these currents

    • Determine ion selectivity and gating properties

By integrating data from these complementary approaches, researchers can build a comprehensive model of MT-ND4L's precise contribution to the proton translocation mechanism of Complex I, advancing our fundamental understanding of this crucial bioenergetic process .

What emerging technologies show the most promise for overcoming current limitations in MT-ND4L research?

Several cutting-edge technologies are poised to revolutionize MT-ND4L research by addressing persistent technical challenges in studying this hydrophobic membrane protein:

  • Cryo-Electron Tomography with Focused Ion Beam Milling:

    • Enables visualization of Complex I within intact mitochondria

    • Provides structural information in native membrane environments

    • Allows detection of conformational states not captured in purified samples

    • Facilitates correlation between Complex I structure and mitochondrial morphology

  • Single-Particle Cryo-EM with Improved Detectors:

    • Achieves near-atomic resolution of membrane proteins without crystallization

    • Captures multiple functional states in a single sample

    • Enables structural analysis of smaller subcomplexes containing MT-ND4L

    • Requires minimal sample amounts compared to traditional structural approaches

  • Advanced Mass Spectrometry Techniques:

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Cross-linking mass spectrometry for interaction mapping

    • Native mass spectrometry for intact complex analysis

    • Targeted proteomics approaches for quantification of low-abundance assembly intermediates

  • Genome Editing in Model Systems:

    • CRISPR-Cas9 editing of nuclear-encoded MT-ND4L in appropriate models

    • Mitochondrially-targeted nucleases for direct editing of mtDNA

    • Base editors and prime editors for introducing specific point mutations

    • Tissue-specific and inducible editing systems for temporal control

  • Microfluidic Systems and Organ-on-Chip Technologies:

    • High-throughput screening of compounds affecting MT-ND4L function

    • Real-time monitoring of respiratory activity in response to perturbations

    • Integration with imaging for simultaneous structural and functional analysis

    • Simulation of tissue-specific environments for context-dependent studies

  • Advanced Computational Methods:

    • Machine learning approaches for predicting mutation effects

    • Enhanced molecular dynamics simulations with specialized force fields for membrane proteins

    • Quantum mechanical calculations for electron transfer processes

    • Systems biology modeling of Complex I integration in cellular metabolism

  • Single-Molecule Techniques:

    • Fluorescence correlation spectroscopy for protein dynamics

    • Magnetic tweezers for measuring protein-protein interaction forces

    • Single-molecule FRET for conformational change detection

    • Optical tweezers for mechanical unfolding studies

These emerging technologies will enable researchers to overcome current limitations in studying MT-ND4L, including its high hydrophobicity, dynamic nature, and integration within the larger Complex I structure .

What are the most critical unanswered questions regarding MT-ND4L that future research should prioritize?

Despite decades of research on mitochondrial Complex I, several critical questions regarding MT-ND4L remain unanswered. Future research should prioritize the following fundamental questions:

  • Precise Mechanistic Role in Proton Pumping:

    • How does MT-ND4L contribute to the proton translocation pathway?

    • Which specific residues participate directly in proton transfer?

    • How are conformational changes in MT-ND4L coupled to redox reactions at the hydrophilic domain?

    • What is the exact stoichiometry of protons pumped through pathways involving MT-ND4L?

  • Evolutionary Adaptations in Nuclear-Encoded Variants:

    • What molecular mechanisms facilitate the import of nuclear-encoded MT-ND4L despite its hydrophobicity?

    • How have nuclear-encoded variants evolved to maintain function while adapting to cytosolic translation?

    • What selective pressures have driven the gene transfer event in certain lineages?

    • Are there functional differences between mitochondrially-encoded and nuclear-encoded variants?

  • Tissue-Specific Functions and Vulnerabilities:

    • Why do mutations in MT-ND4L predominantly affect specific tissues like retinal ganglion cells?

    • Are there tissue-specific interaction partners or regulatory mechanisms?

    • How does MT-ND4L function differ between tissues with varying metabolic demands?

    • What compensatory mechanisms exist in tissues that are resistant to MT-ND4L dysfunction?

  • Role in Complex I Assembly Pathway:

    • At what precise step does MT-ND4L integrate into the Complex I assembly process?

    • Which assembly factors directly interact with MT-ND4L during biogenesis?

    • How is MT-ND4L quality control maintained during assembly?

    • What determines the stability of MT-ND4L within the assembled complex?

  • Supramolecular Organization:

    • How does MT-ND4L contribute to respiratory supercomplex formation?

    • Are there direct interactions between MT-ND4L and components of other respiratory complexes?

    • How does the lipid environment modulate MT-ND4L function within Complex I?

    • Does MT-ND4L participate in interactions with mitochondrial membrane microdomains?

  • Therapeutic Targeting Potential:

    • Can small molecules specifically modulate MT-ND4L function within Complex I?

    • Are there natural compounds that compensate for MT-ND4L dysfunction?

    • Could gene therapy approaches effectively replace dysfunctional MT-ND4L?

    • What biomarkers would indicate successful therapeutic targeting of MT-ND4L-related dysfunction?

Addressing these critical questions will significantly advance our understanding of mitochondrial biology and potentially lead to therapeutic approaches for mitochondrial disorders associated with MT-ND4L dysfunction .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.