Recombinant Galeopterus variegatus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant MT-ND4L is synthesized in bacterial systems with optimized protocols:

ParameterDetailSource
Host OrganismEscherichia coli (BL21 strain)
Tag SystemN-terminal His-tag (for affinity chromatography)
Purity>85–90% (SDS-PAGE validated)
Storage BufferTris-based buffer, 50% glycerol, pH 8.0
StabilityAliquots stored at -20°C/-80°C; avoid repeated freeze-thaw cycles

Key Considerations:

  • Expression Challenges: Hydrophobic regions require specialized solubilization agents (e.g., detergents) .

  • Quality Control: SDS-PAGE and Western blotting confirm purity and identity .

Functional Role in Complex I

MT-ND4L is integral to Complex I’s proton-pumping mechanism:

  • Electron Transfer: Facilitates NADH-to-ubiquinone electron flow, generating a proton gradient for ATP synthesis .

  • Proton Translocation: Forms part of the transmembrane domain that pumps 4 H⁺ per NADH molecule .

Notable Findings:

  • Proton Translocation: Mutations (e.g., T10609C) alter water channel dynamics, reducing proton flux .

  • Complex I Assembly: Coexpression with ND6 subunit is critical for functional integrity .

Clinical Relevance

MT-ND4L mutations are implicated in mitochondrial disorders:

DiseaseGenetic MutationMechanismSource
Leber Hereditary Optic Neuropathy (LHON)T10663C (Val65Ala)Impaired Complex I activity, reduced ATP production
Type 2 Diabetes MellitusT10609C (Met47Thr)Disrupted proton translocation, increased ROS
CataractsC10676G (Cys69Trp)Altered hydrophobic interactions, impaired electron flow

Therapeutic Implications:

  • Targeted Therapies: Modulating Complex I activity to restore ATP production in LHON and metabolic disorders .

  • Biomarkers: Mutations in MT-ND4L may serve as diagnostic markers for mitochondrial diseases .

Comparative Analysis with Human MT-ND4L

While structurally conserved, species-specific differences exist:

ParameterGaleopterus variegatusHomo sapiensSource
Gene Length297 bp (98 aa)297 bp (98 aa)
Expression HostE. coli (recombinant)Native mitochondrial expression
Disease AssociationLimited data (recombinant use in research)LHON, metabolic disorders

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your preferences whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your application.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles to maintain product integrity.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be defined during production. If you have a preferred tag type, please communicate it to us, and we will prioritize incorporating it into the production process.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Galeopterus variegatus (Malayan flying lemur) (Cynocephalus variegatus)
Target Names
Target Protein Sequence
MPPIYINIILAYTASLVGLLMYRSHFMSSLLCLEGMMLSLFILATILSLNLHFTLSFTLP IILLIFAGCETAVGLALLVMISDIYGLDHVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does the MT-ND4L gene in Galeopterus variegatus compare to homologs in other species?

When comparing MT-ND4L across species, evolutionary adaptations become apparent:

SpeciesGene LocationSize (amino acids)Notable Features
Galeopterus variegatusMitochondrial98Highly hydrophobic transmembrane protein
Homo sapiensMitochondrial (10,469-10,765 bp)987-nucleotide overlap with MT-ND4 gene
Mus musculusMitochondrial98Similar structure to human homolog
Chlamydomonas reinhardtiiNuclear (NUO11)VariableTransferred from mitochondria to nucleus

The most striking evolutionary difference is observed in Chlamydomonas reinhardtii, where the gene has been transferred to the nuclear genome and shows decreased hydrophobicity compared to mitochondrially-encoded counterparts, facilitating proper import into mitochondria after cytoplasmic synthesis .

A methodological approach to conducting comparative analysis involves:

  • Multiple sequence alignment using tools like CLUSTAL-W

  • Hydropathy profile analysis using Kyte-Doolittle scale with a 7-residue window

  • Alpha-helix prediction using Deleage-Roux and Levitt scales

  • Calculation of local and regional hydrophobicity using scanning windows of 17 and 60-80 residues respectively

What are the optimal conditions for expressing recombinant Galeopterus variegatus MT-ND4L protein in laboratory settings?

Expression of recombinant Galeopterus variegatus MT-ND4L presents significant challenges due to its highly hydrophobic nature. Based on methodological insights from similar proteins:

  • Expression System Selection:

    • Bacterial systems (E. coli) are suitable for initial expression attempts but may require optimization of detergents

    • Eukaryotic systems like yeast or insect cells better accommodate membrane proteins

    • Cell-free expression systems can be effective for toxic membrane proteins

  • Solubilization Strategy:

    • Buffer composition: Tris-based buffer with 50% glycerol optimized for protein stability

    • Detergent selection: Dodecylmaltoside (2.5% w/v) effectively solubilizes without denaturing

    • For complex formation studies, add 1% sodium taurodeoxycholate prior to separation

  • Purification Approach:

    • Begin with affinity chromatography using appropriate tag (determined during production process)

    • Implement size exclusion chromatography in detergent-containing buffers

    • Store in aliquots at -20°C for short-term or -80°C for long-term stability

  • Critical Parameters to Monitor:

    • Prevent repeated freeze-thaw cycles which compromise protein integrity

    • Validate proper folding through activity assays

    • Confirm mitochondrial targeting sequence processing when using eukaryotic systems

Researchers should note that expression yield may be lower than soluble proteins due to the hydrophobic nature of MT-ND4L .

What techniques are most effective for studying the assembly of MT-ND4L into functional Complex I?

Investigating MT-ND4L assembly into Complex I requires specialized approaches:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):

    • The gold standard for analyzing intact respiratory complexes

    • Procedure: Solubilize mitochondrial membranes with dodecylmaltoside (2.5% w/v)

    • Separate on 4-12% acrylamide gradient gel

    • Detect complex assembly through:
      a) NADH/NBT staining for functional Complex I
      b) Coomassie blue staining for total protein visualization
      c) Immunoblotting with specific antibodies

  • Activity Measurements:

    • NADH:ferricyanide oxidoreductase assay quantifies electron transport capability

    • Spectrophotometric monitoring of NADH oxidation (340 nm) in the presence of inhibitors like rotenone

  • Complex I Assembly Analysis:

    • RNA interference methodology to suppress MT-ND4L expression:
      a) Design target-specific siRNA or shRNA constructs
      b) Validate knockdown efficiency via RNA blotting
      c) Analyze resulting assembly defects through BN-PAGE

  • Super-Resolution Microscopy:

    • Visualize co-localization of fluorescently tagged MT-ND4L with other Complex I components

    • Track assembly intermediates in live cells

Studies in Chlamydomonas reinhardtii demonstrated that absence of ND4L prevents assembly of the complete 950-kDa Complex I and abolishes enzyme activity, revealing its essential role in complex formation .

How can mutations in MT-ND4L be effectively modeled to study disease mechanisms?

Modeling MT-ND4L mutations requires sophisticated approaches:

  • Mutation Analysis Methods:

    • Site-directed mutagenesis to introduce specific mutations (e.g., T10663C/Val65Ala associated with LHON)

    • CRISPR-Cas9 technology adapted for mitochondrial genome editing

    • Heteroplasmy modeling to reflect variable mutation loads observed clinically

  • Functional Assessment Framework:

    Assessment TypeMethodologyParameters Measured
    Complex I AssemblyBN-PAGE with immunodetectionAssembly intermediates, intact complex levels
    Electron TransportSpectrophotometric assaysNADH oxidation rates, inhibitor sensitivity
    ROS ProductionFluorescent probes (MitoSOX)Superoxide levels in live cells
    ATP ProductionLuciferase-based ATP assaysCellular ATP content
    Membrane PotentialTMRM or JC-1 stainingΔψm changes in response to substrates
  • Cellular Models Comparison:

    • Cybrid cells: Patient-derived mitochondria in standard nuclear background

    • Recombinant expression systems: Controlled mutation introduction

    • iPSC-derived neurons: Disease-relevant cell types with patient genetics

  • In Vivo Approaches:

    • Mouse models with introduced MT-ND4L mutations

    • Evaluation of tissue-specific effects, particularly in high-energy tissues

    • Behavioral assessments for neurodegenerative phenotypes

When studying the T10663C/Val65Ala mutation associated with Leber hereditary optic neuropathy (LHON), researchers should assess both biochemical defects and tissue-specific manifestations, particularly in retinal ganglion cells .

What are the most promising approaches for investigating nuclear-mitochondrial gene transfer of MT-ND4L as observed in some species?

The phenomenon of MT-ND4L gene transfer from mitochondria to nucleus, as observed in Chlamydomonas reinhardtii, provides insights into evolutionary mechanisms:

  • Comparative Genomic Approach:

    • Systematically analyze MT-ND4L gene location across phylogenetically diverse species

    • Identify transition species where both nuclear and mitochondrial copies exist

    • Reconstruct evolutionary history using molecular clock analyses

  • Functional Adaptation Assessment:

    • Compare hydrophobicity profiles between nuclear-encoded and mitochondrial-encoded homologs

    • Analyze acquisition of mitochondrial targeting sequences

    • Examine codon usage optimization for nuclear expression

  • Experimental Transfer Models:

    • Engineer nuclear expression of normally mitochondria-encoded MT-ND4L

    • Assess protein import efficiency and functional integration

    • Create chimeric constructs to identify critical regions for successful transfer

  • Mechanisms of Decreased Hydrophobicity:
    Nuclear-encoded ND4L in Chlamydomonas displays significantly lower hydrophobicity than mitochondrially-encoded counterparts, facilitating cytoplasmic synthesis and subsequent import. The methodological approach includes:

    • Hydropathy profile assessment using Kyte-Doolittle scale

    • Mesohydrophobicity calculation using MITOPROT with 60-80 residue scanning windows

    • Alpha-helix predisposition determination using specialized algorithms

Research in Chlamydomonas revealed that nuclear-encoded MT-ND4L displays adaptations in codon usage and decreased hydrophobicity that facilitate proper expression and import into mitochondria, providing a model for understanding evolutionary gene transfer .

What methodologies are most effective for investigating the role of MT-ND4L in Complex I dysfunction related to neurodegenerative disorders?

Complex I dysfunction involving MT-ND4L has been implicated in neurodegenerative conditions like Parkinson's disease and Leber hereditary optic neuropathy (LHON). Research approaches include:

  • Cellular Models of Complex I Inhibition:

    • Treatment with specific Complex I inhibitors (rotenone, pyridaben)

    • Generation of MT-ND4L knockout or mutation models

    • Assessment of neuron-specific vulnerability patterns

  • Complementation Studies:

    • Introduction of alternative NADH dehydrogenases (e.g., NDI1 from Saccharomyces cerevisiae)

    • Expression using viral vectors (adeno-associated virus)

    • Functional rescue assessment in neuronal models

  • Experimental Protocol for NDI1 Complementation:

    • Generate recombinant adeno-associated virus vector carrying NDI1 gene

    • Transduce neuronal cell lines (e.g., PC12, MN9D)

    • Challenge with Complex I inhibitors

    • Assess:
      a) Cell viability and function
      b) Morphological maturation (neurite outgrowth)
      c) Subcellular distribution of expressed protein

  • Therapeutic Potential Assessment:

    • Single-subunit NADH dehydrogenases can functionally replace Complex I

    • Expressed NDI1 localizes to both cell bodies and neurites

    • NDI1-expressing cells show resistance to rotenone and pyridaben

    • Maintain capability for morphological maturation

This approach demonstrates that alternative NADH dehydrogenases may represent promising therapeutic tools for neurodegenerative conditions caused by Complex I dysfunction involving MT-ND4L .

How can researchers effectively analyze the interaction between MT-ND4L and other subunits of Complex I?

Investigating subunit interactions within Complex I requires specialized techniques:

  • Crosslinking Mass Spectrometry (XL-MS):

    • Apply membrane-permeable crosslinkers to intact mitochondria

    • Isolate Complex I via immunoprecipitation

    • Digest and analyze by LC-MS/MS

    • Identify crosslinked peptides to map spatial relationships

  • Cryo-Electron Microscopy:

    • Prepare highly purified Complex I samples

    • Collect high-resolution micrographs

    • Determine the position of MT-ND4L relative to other subunits

    • Visualize conformational changes during catalytic cycle

  • Co-Immunoprecipitation Studies:

    • Generate antibodies against MT-ND4L or use epitope tags

    • Pull down associated proteins under native conditions

    • Identify interaction partners by mass spectrometry

    • Validate specific interactions with complementary methods

  • Genetic Suppressor Analysis:

    • Introduce mutations in MT-ND4L

    • Screen for compensatory mutations in other subunits

    • Map genetic interactions to structural interfaces

  • Structure-Function Analysis:
    Complex I has an L-shaped structure with:

    • Hydrophobic transmembrane domain (includes MT-ND4L)

    • Hydrophilic peripheral arm containing redox centers

    • MT-ND4L forms part of the core transmembrane region

    • Specific interfaces with ND1 and ND6 subunits

Research using these approaches has revealed that MT-ND4L is essential for Complex I assembly, as its absence prevents formation of the complete 950-kDa complex and abolishes enzymatic activity .

What are the most significant technical challenges in studying recombinant Galeopterus variegatus MT-ND4L, and how can they be addressed?

Researchers face several technical challenges when working with recombinant Galeopterus variegatus MT-ND4L:

  • Extreme Hydrophobicity Management:

    • Challenge: High hydrophobicity causes aggregation and misfolding

    • Solution: Optimize detergent types and concentrations (2.5% dodecylmaltoside)

    • Alternative: Design chimeric constructs with soluble tags or domains

    • Storage recommendation: 50% glycerol in Tris-based buffer at -20°C

  • Functional Assessment Limitations:

    • Challenge: Isolating MT-ND4L activity from whole Complex I

    • Solution: Complementation approaches using knockout systems

    • Methodology: RNA interference to suppress native expression followed by recombinant introduction

    • Analysis: Blue Native PAGE with NADH/NBT activity staining

  • Species-Specific Adaptations:

    • Challenge: Variations between Galeopterus variegatus and model organisms

    • Solution: Comparative analysis across species with structure-guided mutations

    • Approach: Systematic mutation of residues that differ between species

    • Assessment: Functional integration into host Complex I

  • Mitochondrial Targeting:

    • Challenge: Ensuring proper localization of nuclear-expressed protein

    • Solution: Optimize mitochondrial targeting sequences

    • Methodology: Decrease hydrophobicity without compromising function

    • Validation: Confocal microscopy with mitochondrial co-localization

Future technological innovations that may address these challenges include:

  • Cell-free expression systems optimized for membrane proteins

  • Nanodiscs for stabilizing hydrophobic proteins in native-like environments

  • Advanced computational modeling of membrane protein folding and interactions

What are promising future research directions for MT-ND4L studies in comparative phylogenetics and mitochondrial evolution?

Future research on MT-ND4L presents several promising directions for understanding mitochondrial evolution:

  • Comparative Genomic Analysis:

    • Expand phylogenetic coverage of MT-ND4L sequences across diverse taxa

    • Identify additional cases of mitochondria-to-nucleus gene transfer

    • Map evolutionary paths of gene relocation events

    • Investigate selection pressures driving gene transfer

  • Structure-Function Evolution:

    • Compare MT-ND4L structural adaptations across evolutionary lineages

    • Correlate structural changes with functional adaptations

    • Investigate co-evolution with interacting subunits

    • Develop a comprehensive model of Complex I evolution

  • Methodological Framework for Nuclear Transfer Analysis:

    • Compare nuclear-encoded versus mitochondrial-encoded MT-ND4L properties:

    PropertyMitochondrial-EncodedNuclear-EncodedAnalytical Method
    HydrophobicityHigherLowerKyte-Doolittle scale
    Codon UsageMitochondrial patternNuclear patternCodon Adaptation Index
    α-helix PropensityVariableModifiedDeleage-Roux/Levitt scales
    Targeting SequencesAbsentPresentMITOPROT prediction
  • Evolutionary Medicine Applications:

    • Study MT-ND4L variants across human populations

    • Correlate variants with disease susceptibility

    • Develop personalized approaches to mitochondrial disorders

    • Investigate adaptive mutations in populations with specific metabolic demands

  • Integration with Single-Cell Omics:

    • Analyze cell-type specific expression patterns

    • Investigate tissue-specific impacts of mutations

    • Correlate with metabolic adaptations

The unique case of MT-ND4L transfer to the nucleus in certain species like Chlamydomonas provides a valuable model for understanding the mechanisms and consequences of mitochondria-to-nucleus gene transfer during evolution .

MT-ND4L Research Protocol Supplement

This supplement provides additional methodological details for key experimental approaches discussed in the FAQs.

Protocol: Blue Native PAGE Analysis of Complex I Assembly

Materials Required:

  • Purified mitochondria or crude membrane fractions

  • Dodecylmaltoside (2.5% w/v)

  • 375 mM 6-aminohexanoic acid

  • 250 mM EDTA

  • 25 mM Bis-Tris, pH 7.0

  • 1% sodium taurodeoxycholate

  • 4-12% acrylamide gradient BN gel

  • NADH/NBT staining solution

Procedure:

  • Solubilize protein complexes in buffer containing dodecylmaltoside

  • Centrifuge at 15,000 x g (20 min, 4°C) to remove insoluble material

  • Add sodium taurodeoxycholate to supernatant

  • Separate by electrophoresis on acrylamide gradient gel

  • For activity staining, incubate gel with NADH/NBT solution

  • For protein visualization, stain with Coomassie blue

  • For specific detection, perform immunoblotting with antibodies against Complex I components

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.