Recombinant Galeus melastomus Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Galeus melastomus (Blackmouth catshark)
Target Names
rho
Target Protein Sequence
MNGTEGENFYVPMSNKTGVVRNPFEYPQYYLADHWMFAVLAAYMFFLIITGFPVNFLTLF VTIQNKKLRQPLNYILLNLAVANLFMVFGGFTTTLITSMNGYFVFGSTGCNLEGFFATLG GEISLWSLVVLAIERYVVVCKPMSNFRFGSQHAIAGVSLTWVMAMACAAPPLVGWSRYIP EGLQCSCGIDYYTPKPEINNVSFVIYMFVVHFSIPLTIIFFCYGRLVCTVKAAAAQQQES ETTQRAEREVTRMVVIMVIGFLICWLPYASVALYIFNNQGSEFGPVFMTIPSFFAKSSAL YNPLIYILMNKQFRNCMITTLCCGKNPFEEEESTSASASKTEASSVSSSQVSPA
Uniprot No.

Target Background

Function
Rhodopsin, a photoreceptor, plays a crucial role in image-forming vision under low light conditions. While most saltwater fish utilize retinal as the chromophore, most freshwater fish employ 3-dehydroretinal, or a combination of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating signaling through G-proteins. Subsequent phosphorylation of the receptor facilitates the displacement of the bound G-protein alpha subunit by arrestin, terminating the signaling process.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Galeus melastomus rhodopsin and what is its functional significance?

Galeus melastomus rhodopsin (Rh1) is the primary visual pigment found in rod photoreceptors of the blackmouth catshark. This G-protein-coupled receptor (GPCR) plays a crucial role in dim-light vision, particularly important for this deep-water species that inhabits depths ranging from 116 to 1060 meters . Like other rhodopsins, it consists of an opsin protein covalently linked to a retinal chromophore via a Schiff base at position K296, which undergoes photoisomerization upon light absorption . This conformational change triggers visual transduction cascades through G-protein coupling, primarily through the Gi/o signaling pathway .

What are the conserved structural features of Galeus melastomus rhodopsin?

Galeus melastomus rhodopsin shares several key structural elements with other vertebrate rhodopsins:

  • Seven transmembrane domains (TMDs) forming the core structure

  • Conserved cysteine (C) residues at positions 110 (TMD3), 187 (ECD2) involved in disulphide bond formation

  • A conserved glutamate (E) at position 113 (TMD3) providing the negative counterion to the Schiff base proton

  • A conserved glutamate (E) at position 134 (TM3) stabilizing the inactive opsin molecule

  • A conserved lysine (K) at position 296 (TM7) forming the Schiff base linkage with the chromophore

  • Conservation of two cysteine (C) residues at palmitoylation positions 322 and 323

  • Multiple Ser (S) and Thr (T) residues in the C-terminus, serving as potential phosphorylation targets for rhodopsin kinases

  • Conserved glycosylation sites at positions 2 and 15

These structural elements are essential for proper protein folding, chromophore binding, photochemical function, and signal transduction.

How does Galeus melastomus rhodopsin compare with other visual pigments?

Comparative analysis reveals both similarities and differences between Galeus melastomus rhodopsin and other visual pigments:

  • As an Rh1 (rod opsin) pigment, it is functionally distinct from cone opsins such as Rh2 (middle-wavelength-sensitive) and LWS (long-wavelength-sensitive)

  • While sharing core structural features with other rhodopsins, Galeus melastomus rhodopsin likely possesses specific amino acid substitutions at key tuning sites that optimize its spectral sensitivity for the deep-sea environment

  • Unlike cone opsins that typically mediate color vision, Galeus melastomus rhodopsin primarily functions in scotopic (low-light) vision

  • Most shark rhodopsins couple to Gi/o-type G-proteins, similar to bovine rhodopsin, triggering the inhibition of adenylyl cyclase and reduction in cyclic adenosine monophosphate (cAMP) levels

How can recombinant Galeus melastomus rhodopsin be expressed and purified?

Based on experimental approaches described for similar visual pigments, the following protocol can be used for recombinant Galeus melastomus rhodopsin:

  • Gene Cloning and Vector Construction:

    • Isolate total RNA from Galeus melastomus retinal tissue

    • Synthesize cDNA using reverse transcriptase

    • Amplify the rhodopsin coding sequence using PCR with gene-specific primers

    • Clone the amplified sequence into an expression vector (e.g., pMT4)

  • Heterologous Expression:

    • Transfect mammalian cells (typically HEK293 or COS-1) with the expression construct

    • Maintain cells in darkness to prevent pigment bleaching

    • Supplement medium with 9-cis-retinal (which serves as an effective chromophore replacement)

  • Protein Purification:

    • Harvest cells and solubilize membranes using n-dodecyl-β-d-maltoside (DDM)

    • Purify the recombinant protein using immunoaffinity chromatography

    • Elute in buffer containing 20 mM bis-tris-propane (pH 7.0), 120 mM NaCl, 2 mM MgCl₂, and 1 mM DDM

  • Functional Verification:

    • Assess proper folding and chromophore binding by UV-visible spectroscopy

    • Verify G-protein activation capability through fluorescence-based assays

What are effective methods for analyzing spectral properties of Galeus melastomus rhodopsin?

Several complementary techniques can be employed to characterize the spectral properties of recombinant Galeus melastomus rhodopsin:

  • UV-Visible Absorption Spectroscopy:

    • Record absorption spectra of purified pigment to determine λmax (wavelength of maximum absorption)

    • Monitor spectral shifts following light exposure to assess photochemical properties

    • Measure extinction coefficients to quantify chromophore binding

  • Site-Directed Mutagenesis Studies:

    • Systematically mutate key amino acids known to affect spectral tuning:

      • Position 83: Asp83Asn substitution typically causes a 6 nm short-wavelength shift

      • Position 122: Glu122Gln substitution typically causes a 19 nm short-wavelength shift

      • Position 207: Modifications can cause ~6 nm shifts

      • Position 292: Ser292Ala changes can cause ~8 nm shifts

      • Position 295: Modifications typically generate ~5 nm shifts

    • Analyze additive effects of multiple substitutions, which can generate cumulative shifts of up to 39 nm

  • G-Protein Activation Assays:

    • Measure GTPγS binding kinetics following photoactivation

    • Use fluorescence-based assays with purified G-proteins (typically at a 10:1 G-protein:rhodopsin molar ratio)

    • Derive pseudo-first order kinetic rates (k) using the function: A(t) = Amax(1 − exp−kt)

  • In Vivo Functional Assays:

    • Express recombinant rhodopsin in model organisms such as C. elegans

    • Monitor light-induced behavioral responses as functional readouts

How can site-directed mutagenesis be used to investigate Galeus melastomus rhodopsin function?

Site-directed mutagenesis is a powerful approach for structure-function analysis of rhodopsin:

  • Key Target Sites for Mutagenesis:

    • Spectral Tuning Sites:

      • Position 83: Affects spectral sensitivity by ~6 nm

      • Position 122: Major tuning site affecting λmax by ~19 nm

      • Position 207: Influences spectral properties by ~6 nm

      • Position 292: Modifies λmax by ~8 nm and affects chloride binding

      • Position 295: Shifts spectral sensitivity by ~5 nm

    • Structural/Functional Sites:

      • Position 113: Critical for counterion function

      • Position 181/292: Important for chloride binding and spectral tuning

      • Position 296: Essential for chromophore attachment

  • Experimental Design:

    • Generate single and multiple mutations using PCR-based methods

    • Create combinatorial mutants to investigate interaction effects

    • Pay special attention to chloride-binding sites (positions 181 and 292)

  • Functional Analysis of Mutants:

    • Measure absorption spectra to quantify λmax shifts

    • Assess G-protein activation kinetics

    • Investigate protein stability and folding efficiency

    • Examine the effects on chloride binding and its impact on spectral properties

  • Data Interpretation:

    • Compare observed spectral shifts with predictions from additive models

    • Note that some mutations show non-additive effects; for example, His181Tyr and Ala292Ser mutations in related pigments do not produce the predicted additive shift

    • Construct molecular models to visualize how mutations affect the chromophore environment

How do specific amino acid residues influence spectral tuning in Galeus melastomus rhodopsin?

The spectral sensitivity (λmax) of Galeus melastomus rhodopsin, like other visual pigments, is fine-tuned by specific amino acid residues that interact with the chromophore:

What can be inferred about the molecular evolution of Galeus melastomus rhodopsin?

Although specific phylogenetic information about Galeus melastomus rhodopsin is limited in the available data, several evolutionary insights can be drawn:

  • Evolutionary Conservation:

    • Critical structural features are highly conserved across diverse vertebrate lineages, indicating strong functional constraints

    • Key residues for chromophore binding, G-protein coupling, and structural integrity show minimal variation

  • Adaptive Evolution:

    • Spectral tuning sites show greater variability, reflecting adaptation to diverse light environments

    • As a deep-water species, Galeus melastomus likely possesses rhodopsin adaptations that optimize sensitivity to the blue-shifted light available at depths of 116-1060 meters

  • Genetic Markers:

    • Microsatellite loci are "particularly well-conserved over time in related families (i.e., Triakidae with G. galeus and Mustelus spp.), but also in phylogenetically more distant families"

    • This suggests that while Galeus melastomus (family Pentachidae) is phylogenetically distinct from species in families like Triakidae and Hexanchidae, there are conserved genetic elements across shark lineages

  • Population Genetics:

    • Galeus melastomus shows "signs of weak, but tangible genetic structure" across its range

    • Distinct genetic units have been identified, including differentiation of Scottish populations from Mediterranean samples

    • This genetic structure may potentially extend to visual system genes, including rhodopsin, if local light environments differ

What is the relationship between G-protein coupling specificity and Galeus melastomus rhodopsin function?

The signaling pathway activated by Galeus melastomus rhodopsin determines its physiological effects:

  • G-protein Coupling Specificity:

    • Rhodopsins typically couple to Gi/o-type G-proteins, while other opsins like melanopsin primarily activate Gq signaling

    • This coupling specificity results in distinct downstream effects:

      • Gi/o signaling inhibits adenylyl cyclase, reducing cAMP levels

      • Gq signaling activates phospholipase Cβ, increasing intracellular calcium

  • Functional Consequences:

    • In experimental models, Gi/o-coupled rhodopsin activation leads to "sudden and transient loss of motility dependent on cyclic adenosine monophosphate"

    • In contrast, Gq-coupled opsin activation "enhanced locomotion dependent on phospholipase Cβ"

    • These distinct effects demonstrate the physiological significance of G-protein coupling specificity

  • Experimental Measurement:

    • G-protein activation can be measured using fluorescence-based assays

    • Typical experimental parameters include:

      • 10:1 molar ratio of G-protein to rhodopsin (250 nM G-protein, 25 nM rhodopsin)

      • Buffer composition: 20 mM bis-tris-propane (pH 7.0), 120 mM NaCl, 2 mM MgCl₂, 1 mM DDM

      • Light exposure: 15 seconds with a 480-520 nm bandpass filter

      • GTPγS addition (5 μM) after 300 seconds of incubation

      • Kinetic analysis using the function: A(t) = Amax(1 − exp−kt)

  • Structural Determinants:

    • The intracellular loops and C-terminal region of rhodopsin interact with G-proteins

    • Conserved residues in these regions are critical for proper G-protein coupling

How does Galeus melastomus rhodopsin adapt to deep-sea environments?

Blackmouth catsharks inhabit depths ranging from 116 to 1060 meters , requiring visual adaptations to the limited light available at these depths:

  • Spectral Sensitivity Adaptations:

    • Deep-sea environments are characterized by predominantly blue light (~480 nm)

    • Rhodopsins in deep-sea species often show spectral tuning that optimizes sensitivity to available wavelengths

    • Specific amino acid substitutions at key tuning sites (positions 83, 122, 207, 292, 295) likely contribute to spectral optimization

  • Sensitivity Enhancements:

    • Deep-sea visual systems often show adaptations for increased photon capture

    • These may include higher expression levels of rhodopsin, specialized retinal architecture, and efficient signal transduction

  • Comparative Context:

    • The search results mention "some deep-sea teleosts" when discussing spectral tuning substitutions

    • This suggests parallel adaptations across different deep-sea fish lineages, including sharks

    • Adaptations may be convergent despite phylogenetic distance

  • Evolutionary Implications:

    • Strong selective pressure for optimal visual function in low-light environments

    • Balance between spectral tuning for available light and maintenance of structural integrity

What population genetic patterns exist in Galeus melastomus across geographic regions?

Population genetic studies reveal structural patterns in Galeus melastomus populations:

How can functional studies of Galeus melastomus rhodopsin inform conservation efforts?

Understanding the visual biology of Galeus melastomus can contribute to conservation strategies:

  • Fisheries Impact Assessment:

    • Galeus melastomus is "highly represented in the bycatch composition of commercial fisheries"

    • Knowledge of visual capabilities can inform fishing practices to reduce bycatch

    • Understanding how fishing gear is perceived by the species could lead to modified gear designs

  • Habitat Requirements:

    • Visual adaptations reflect evolutionary constraints of the species' natural environment

    • This information contributes to understanding the ecological niche and habitat requirements

    • Marine protected areas could be designed considering depth ranges appropriate for the species' visual system

  • Environmental Change Vulnerability:

    • Climate change and pollution may alter light environments in marine ecosystems

    • Understanding the spectral sensitivity and adaptability of visual pigments helps predict vulnerability to such changes

    • Highly specialized visual systems may indicate reduced adaptability to changing conditions

  • Monitoring Approaches:

    • Knowledge of visual capabilities informs the design of monitoring technologies

    • Camera systems used for population surveys can be optimized based on species' visual sensitivities

    • Non-invasive monitoring techniques can be developed that account for the species' visual perception

How can optogenetic applications utilize recombinant Galeus melastomus rhodopsin?

Recombinant shark rhodopsins offer unique properties for optogenetic applications:

  • Heterologous Expression Systems:

    • Galeus melastomus rhodopsin can be expressed in various model organisms, similar to bovine rhodopsin in C. elegans

    • "Profound transient photoactivation of Gi/o signaling by (b)isoRho led to a sudden and transient loss of worm motility dependent on cyclic adenosine monophosphate"

    • Similar approaches could be developed using shark rhodopsins with potentially distinct spectral and kinetic properties

  • Advantages of Shark Rhodopsins:

    • Deep-sea shark rhodopsins may offer increased sensitivity to low light levels

    • Potentially different spectral tuning compared to mammalian rhodopsins

    • Unique G-protein coupling kinetics or efficacy

  • Experimental Approaches:

    • Express recombinant Galeus melastomus rhodopsin in model organisms

    • Supplement with 9-cis-retinal as chromophore

    • Study light-induced behaviors or cellular responses

    • Optimize light delivery parameters based on spectral sensitivity

  • Potential Applications:

    • Optogenetic control of Gi/o signaling pathways

    • Development of novel biosensors

    • Investigation of deep-sea visual adaptations

What structural biology approaches can best elucidate Galeus melastomus rhodopsin function?

Advanced structural techniques can provide deeper insights into Galeus melastomus rhodopsin:

  • Comparative Homology Modeling:

    • Use the crystal structure of bovine rhodopsin as a template

    • "The model was created using Swiss Model and is based on the crystal structure of bovine rhodopsin"

    • Generate structural models to visualize key residues surrounding the chromophore

  • Cryo-Electron Microscopy:

    • Determine high-resolution structures of Galeus melastomus rhodopsin

    • Capture different conformational states (dark state, photoactivated)

    • Visualize rhodopsin-G-protein complexes

  • Molecular Dynamics Simulations:

    • Model the effects of specific mutations on protein dynamics

    • Investigate water networks and ion binding sites

    • Simulate the photoactivation process and conformational changes

  • Spectroscopic Approaches:

    • Time-resolved spectroscopy to study photoactivation kinetics

    • FTIR spectroscopy to monitor structural changes upon activation

    • Fluorescence spectroscopy to study protein-protein interactions

How can the genome-editing techniques be applied to study Galeus melastomus rhodopsin in vivo?

While challenging in non-model organisms like sharks, emerging genome-editing approaches offer potential for in vivo studies:

  • Technical Challenges:

    • Limited genomic resources for Galeus melastomus

    • Difficult husbandry and long generation times

    • Lack of established embryo manipulation protocols

  • Potential Approaches:

    • CRISPR/Cas9 editing of rhodopsin gene in embryos

    • Development of shark cell lines for in vitro studies

    • Creation of transgenic models expressing modified shark rhodopsins

  • Functional Readouts:

    • Electrophysiological recordings from retinal cells

    • Behavioral assays of visual function

    • Molecular analyses of signal transduction pathways

  • Alternative Approaches:

    • Studies in closely related model species

    • Heterologous expression in established model organisms like zebrafish

    • Ex vivo retinal preparations for functional studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.