Recombinant Gallid herpesvirus 2 Envelope glycoprotein D (MDV094)

Shipped with Ice Packs
In Stock

Description

Description of Recombinant Gallid herpesvirus 2 Envelope Glycoprotein D (MDV094)

Recombinant Gallid herpesvirus 2 Envelope glycoprotein D (MDV094) is a recombinant protein derived from Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987), also known as Marek's disease herpesvirus type 1 . Glycoprotein D (gD) is an envelope glycoprotein of GaHV-2 . The protein sequence is derived from the region spanning amino acids 35-403 of the full-length protein .

Table 1: Recombinant Gallid herpesvirus 2 Envelope Glycoprotein D (MDV094) Details

AttributeDescription
Product TypeRecombinant Protein
SpeciesGallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) (GaHV-2) (Marek's disease herpesvirus type 1)
UniProt No.Q9E6L6
Tag InfoDetermined during production
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
StorageStore at -20℃; for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA SequenceMGLKKDNSPIIPTLHPKGNENLRATLNEYKIPSPLFDTLDNSYETKHVIYTDNCSFAVLN PFGDPKYTLLSLLLMGRRKYDALVAWFVLGRACGRPIYLREYANCSTNEPFGTCKLKSLG WWDRRYAMTSYIDRDELKLIIAAPSRELSGLYTRLIIINGEPISSDILLTVKETCSFSRR GIKDNKLCKPFSFFVNGTTRLLDMVGTGTPRAHEENVKQWLERIGGKHLPIVVETSMQQV SNLPRSFRDSYFKSPDDDKYDDVKMTSATTNNITTSVDGYTGLTNRPEDFEKAPYITKRP IISVEEASSQSPKISTEKKSRTQIIISLVVLCVMFCFIVIGSGIWILRKHRKTVMYDRRR PSRRAYSRL
Protein NamesEnvelope glycoprotein D, gD
Gene NamesMDV094
Expression Region35-403
Sequence InfoFull length protein

Role of Glycoprotein D in Herpesviruses

Glycoprotein D is crucial for herpesvirus entry and may modulate immune responses through interactions with herpesvirus entry mediator (HVEM) on immune cells . gD is also an immunodominant antigen . Studies suggest that gD-based Enzyme-Linked Immunosorbent Assay (ELISA) can be used for efficient screening of serum samples under field conditions .

4.2. Immune Response

Immunization with ΔgD/+gD1 elicited HSV-specific antibodies in serum and vaginal washes . These antibodies mediated cell-mediated cytotoxicity but had limited neutralizing activity . Passive transfer of immune serum conferred protection in wild-type mice, but not in Fcγ-receptor or neonatal Fc-receptor knock-out mice . These findings suggest that non-neutralizing Fc-mediated humoral responses are important for protection .

4.3. Prevention of Latency

Vaccination with HSV-2 ΔgD/+gD-1 prevented the establishment of latency . No infectious virus was recovered from vaginal or neural tissue in vaccinated mice post-infection, and virus reactivation from dorsal root ganglia (DRG) was not observed . Additionally, HSV DNA was undetectable in vaccinated mice .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MDV094; Envelope glycoprotein D; gD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-403
Protein Length
Full Length of Mature Protein
Species
Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) (GaHV-2) (Marek's disease herpesvirus type 1)
Target Names
MDV094
Target Protein Sequence
MGLKKDNSPIIPTLHPKGNENLRATLNEYKIPSPLFDTLDNSYETKHVIYTDNCSFAVLN PFGDPKYTLLSLLLMGRRKYDALVAWFVLGRACGRPIYLREYANCSTNEPFGTCKLKSLG WWDRRYAMTSYIDRDELKLIIAAPSRELSGLYTRLIIINGEPISSDILLTVKETCSFSRR GIKDNKLCKPFSFFVNGTTRLLDMVGTGTPRAHEENVKQWLERIGGKHLPIVVETSMQQV SNLPRSFRDSYFKSPDDDKYDDVKMTSATTNNITTSVDGYTGLTNRPEDFEKAPYITKRP IISVEEASSQSPKISTEKKSRTQIIISLVVLCVMFCFIVIGSGIWILRKHRKTVMYDRRR PSRRAYSRL
Uniprot No.

Target Background

Function

Envelope glycoprotein that binds to host cell entry receptors. It may trigger membrane fusion with the host cell by recruiting the fusion machinery composed of gB and gH/gL.

Protein Families
Herpesviridae glycoprotein D family
Subcellular Location
Virion membrane; Single-pass type I membrane protein.

Q&A

What is Gallid herpesvirus 2 Envelope glycoprotein D and what is its biological significance?

Gallid herpesvirus 2 (GaHV-2) Envelope glycoprotein D, also known as MDV094, is a viral membrane protein expressed in Marek's disease herpesvirus type 1. This glycoprotein plays a critical role in viral entry mechanisms, similar to other herpesvirus envelope glycoproteins. By analogy to other herpesvirus glycoprotein D proteins, MDV094 likely functions by binding to host cell receptors and facilitating viral attachment and entry into target cells. The protein contains characteristic domains essential for receptor binding and membrane fusion processes, making it a key component in the viral infection cycle.

The biological significance of MDV094 extends beyond its direct role in viral entry. The envelope glycoprotein D is part of the complex machinery that enables GaHV-2 to establish infection in chicken cells and contributes to viral pathogenesis and immune evasion strategies. Understanding this protein's structure and function provides valuable insights into the molecular mechanisms underlying Marek's disease, a significant avian pathogen causing lymphomatous disease in chickens.

How does the amino acid sequence of MDV094 compare to glycoprotein D from other herpesviruses?

The MDV094 glycoprotein D amino acid sequence (MGLKKDNSPIIPTLHPKGNENLRATLNEYKIPSPLFDTLDNSYETKHVIYTDNCSFAVLNPFGDPKYTLLSLLLMGRRKYDALVAWFVLGRACGRPIYLREYANCSTNEPFGTCKLKSLGWWDRRYAMTSYIDRDELKLIIAAPSRELSGLYTRLIIINGEPISSDILLTVKETCSFSRRGIKDNKLCKPFSFFVNGTTRLLDMVGTGTPRAHEENVKQWLERIGGKHLPIVVETSMQQVSNLPRSFRDSYFKSPDDDKYDDVKMTSATTNNITTSVDGYTGLTNRPEDFEKAPYITKRPIISVEEASSQSPKISTEKKSRTQIIISLVVLCVMFCFIVIGSGIWILRKHRKTVMYDRRR PSRRAYSRL) reveals conserved domains typical of herpesvirus envelope glycoproteins.

When compared to human herpesvirus glycoprotein D (such as HSV2 gD), MDV094 shares functional homology despite sequence divergence. Both proteins serve as critical mediators of viral entry, binding to host cell receptors. HSV2 gD binds specifically to NECTIN1 and TNFRSF14/HVEM receptors and triggers membrane fusion by recruiting the fusion machinery composed of glycoproteins gB and gH/gL. While the exact host receptors for MDV094 haven't been as thoroughly characterized as those for HSV2 gD, the functional conservation suggests similar mechanisms of action adapted to avian host cells.

Phylogenetically, GaHV-2 is more closely related to gallid herpesvirus 3 (GaHV-3) than to gallid herpesvirus 1 (GaHV-1), and interestingly, meleagrid herpesvirus 1 (turkey herpesvirus) shows greater proximity to both GaHV-2 and GaHV-3 than does GaHV-1. These evolutionary relationships likely influence structural and functional characteristics of their respective glycoproteins.

What are the optimal expression systems for producing recombinant MDV094 for research applications?

The production of functional recombinant MDV094 for research applications requires careful consideration of expression systems to ensure proper folding, post-translational modifications, and biological activity. Based on available research data and protocols for similar herpesvirus glycoproteins, several expression systems have demonstrated efficacy:

Insect cell expression systems (baculovirus) offer a compromise between yield and post-translational modification capability. For highest fidelity to native structure, avian cell lines (such as chicken embryo fibroblasts or DF-1 cells) provide the most authentic cellular environment for expression. The expression region typically used is amino acids 35-403, which encompasses the mature extracellular domain while excluding the signal peptide and transmembrane regions that could complicate purification.

To optimize expression, researchers should consider:

  • Codon optimization for the selected expression system

  • Inclusion of appropriate purification tags (typically His-tag or GST-tag)

  • Temperature and induction conditions to maximize soluble protein yield

  • Secretion signals if using eukaryotic systems

What purification challenges are specific to MDV094 and how can they be addressed?

Purification of recombinant MDV094 presents several challenges characteristic of membrane glycoproteins. The hydrophobic domains and complex tertiary structure can lead to aggregation, misfolding, and low solubility during purification processes.

A methodological approach to purification should include:

  • Initial extraction optimization: For membrane-associated proteins like MDV094, selection of appropriate detergents is critical. A screen of detergents (CHAPS, DDM, or Triton X-100) at varying concentrations can help determine optimal solubilization conditions.

  • Multi-step purification strategy:

    • Initial capture via affinity chromatography (utilizing His-tag or other fusion tags)

    • Intermediate purification via ion exchange chromatography

    • Polishing via size exclusion chromatography to remove aggregates and ensure monodispersity

  • Buffer optimization: Storage in Tris-based buffer with 50% glycerol helps maintain protein stability. The protein should be stored at -20°C for short-term or -80°C for extended storage, with aliquoting recommended to avoid repeated freeze-thaw cycles.

  • Quality control measures: SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering) analysis to confirm homogeneity and proper oligomeric state; glycosylation analysis by mass spectrometry to verify post-translational modifications.

How can researchers design binding assays to study MDV094 interactions with host cell receptors?

Designing robust binding assays for studying MDV094 interactions with host cell receptors requires multiple complementary approaches:

Surface Plasmon Resonance (SPR) Assays:

  • Immobilize purified MDV094 on a sensor chip using amine coupling chemistry

  • Flow potential avian receptor candidates (identified through bioinformatics or homology to known herpesvirus receptors) over the surface

  • Measure association and dissociation kinetics to determine binding affinity (KD)

  • Validate findings with reverse orientation (immobilized receptor, flowing MDV094)

Cell-Based Binding Assays:

  • Express MDV094 with a fluorescent tag (GFP fusion) or label purified protein with fluorophores

  • Incubate with chicken cell lines (such as DF-1 or primary chicken cells)

  • Analyze binding by flow cytometry or confocal microscopy

  • Perform competition assays with unlabeled protein to confirm specificity

Pull-Down Assays for Receptor Identification:

  • Conjugate purified MDV094 to magnetic beads or agarose resin

  • Incubate with solubilized chicken cell membrane preparations

  • Elute bound proteins and identify by mass spectrometry

  • Validate candidate receptors through siRNA knockdown or CRISPR knockout in permissive cell lines

By applying these methodologies, researchers can systematically identify and characterize the host cell receptors utilized by MDV094, providing insights into viral tropism and potential intervention strategies.

What functional assays can demonstrate the biological activity of recombinant MDV094?

To confirm that recombinant MDV094 retains its biological activity, researchers should employ multiple functional assays that reflect its native role in viral entry and infection:

Virus Neutralization Assays:

  • Pre-incubate GaHV-2 with anti-MDV094 antibodies or soluble recombinant MDV094

  • Infect susceptible chicken cells

  • Quantify inhibition of infection by measuring viral plaques or viral protein expression

  • A reduction in infection indicates functional mimicry of the native protein

Cell Fusion Assays:

  • Express MDV094 along with other viral glycoproteins (gB, gH/gL) in one cell population

  • Express putative receptors in a separate cell population

  • Mix cells and observe for syncytia formation

  • Quantify fusion events by fluorescence or luciferase-based reporter systems

Inhibition Studies:

  • Design peptides based on MDV094 binding domains

  • Test their ability to block GaHV-2 infection

  • Structure-function correlation to map critical domains

  • Validate with site-directed mutagenesis of the recombinant protein

These assays not only confirm biological activity but also provide valuable mechanistic insights into how MDV094 functions during viral entry, which can inform vaccine and antiviral development strategies.

How does MDV094 contribute to GaHV-2 virulence and pathogenesis?

MDV094 (glycoprotein D) plays multifaceted roles in GaHV-2 virulence and pathogenesis through several mechanisms:

Viral Entry and Cell-to-Cell Spread:
MDV094 functions analogously to other herpesvirus envelope glycoproteins, mediating viral attachment to host cells and facilitating membrane fusion for viral entry. In herpesviruses, glycoprotein D homologs often bind specific host receptors to initiate the entry process. The protein likely coordinates with other viral glycoproteins (gB, gH/gL complex) to form the core fusion machinery required for both initial entry and subsequent cell-to-cell spread.

Immune Evasion and Modulation:
As a surface-exposed glycoprotein, MDV094 is a target for neutralizing antibodies. Therefore, sequence variations in MDV094 could potentially contribute to immune evasion strategies. While not directly mentioned in the search results, envelope glycoproteins in other herpesviruses have been shown to modulate host immune responses.

Evolutionary and Recombination Dynamics:
While MDV094 itself wasn't specifically identified in the recombination events analyzed in the search results, other GaHV-2 genes involved in recombination between virulent and avirulent strains (like UL49.5) were found to be essential for cell-to-cell spread in vitro, suggesting an important role in the infection process. The evolutionary pressure on surface glycoproteins often reflects their importance in host-pathogen interactions.

Understanding MDV094's role in pathogenesis could inform the development of targeted interventions to disrupt viral entry and spread, potentially leading to more effective control strategies for Marek's disease.

What insights can recombinant MDV094 provide for vaccine development against Marek's disease?

Recombinant MDV094 offers several strategic advantages for Marek's disease vaccine development:

Subunit Vaccine Candidate:
As a key surface antigen, recombinant MDV094 represents a potential subunit vaccine candidate. By eliciting neutralizing antibodies against this critical entry protein, a vaccine could block the initial stages of viral infection. Development of ELISA tests using recombinant MDV094 enables screening of antibody responses to evaluate vaccine efficacy.

Marker Vaccines and DIVA Strategies:
Recombinant MDV094 with introduced epitope tags or mutations could serve as the basis for marker vaccines, allowing differentiation between infected and vaccinated animals (DIVA). This approach is particularly valuable for disease surveillance and control programs.

Vector Vaccine Enhancement:
While current Marek's disease vaccines often use attenuated viruses with modifications to oncogenes (like meq), the inclusion of optimized MDV094 sequences could potentially enhance protective efficacy. The recombinant vaccine strain rMSΔmeq, which has deletions in the meq oncogene, demonstrates high protective efficacy against various GaHV-2 strains. Future iterations could incorporate modifications to enhance MDV094-specific immune responses.

Cross-Protection Analysis:
Studying MDV094 sequence variations across different GaHV-2 strains (including Md5, GA, and CVI988) could predict and explain cross-protection patterns. The protective index (PI) differences observed between vaccine strains like rMSΔmeq and CVI988/Rispens when challenged with variant strains might partially relate to glycoprotein differences, warranting investigation of MDV094's role in strain-specific immunity.

Understanding the immunological responses to MDV094 and its variants across GaHV-2 strains provides rational approaches to designing next-generation vaccines with broader protection against evolving field strains.

How can researchers utilize MDV094 for studying herpesvirus evolution and recombination events?

Researchers can leverage MDV094 as a model system for understanding herpesvirus evolution and recombination through several sophisticated approaches:

Comparative Genomic Analysis:

  • Sequence MDV094 from diverse GaHV-2 isolates collected across different geographic regions and time periods

  • Perform phylogenetic analyses to trace evolutionary relationships

  • Calculate selection pressures (dN/dS ratios) to identify regions under positive, negative, or neutral selection

  • Compare with glycoprotein D sequences from related herpesviruses to identify conserved functional domains versus divergent regions

Recombination Detection:
MDV094 can serve as a marker for detecting and characterizing recombination events in GaHV-2. Phylogenetic analyses of orthologous loci from multiple herpesvirus genomes have already revealed important evolutionary relationships among avian herpesviruses, with gallid HV3 identified as a sister taxon to gallid HV2. By examining the pattern of synonymous nucleotide substitutions between orthologous genes, researchers have detected evidence of homologous recombination events that homogenized certain loci between genomes.

Experimental Evolution Studies:

  • Passage GaHV-2 in the presence of selective pressures (immune sera, receptor decoys, etc.)

  • Sequence MDV094 after multiple passages to identify adaptive mutations

  • Reconstruct ancestral MDV094 sequences to study functional changes over evolutionary time

  • Create chimeric viruses with MDV094 sequences from different strains to map virulence determinants

These approaches provide insights not only into GaHV-2 evolution but also into fundamental mechanisms of herpesvirus adaptation and host-pathogen coevolution.

What techniques can be used to develop MDV094-targeted antivirals or neutralizing antibodies?

Development of MDV094-targeted interventions requires a multi-disciplinary approach combining structural biology, immunology, and medicinal chemistry:

Structure-Based Drug Design:

  • Determine the three-dimensional structure of MDV094 through X-ray crystallography or cryo-electron microscopy

  • Identify potential binding pockets through computational analysis

  • Conduct virtual screening of compound libraries against these pockets

  • Validate hits through binding assays and functional inhibition studies

  • Optimize lead compounds for improved potency and pharmacokinetic properties

Neutralizing Antibody Development:

  • Immunize animals with recombinant MDV094 or selected epitopes

  • Isolate B cells and develop monoclonal antibodies

  • Screen for neutralizing activity in cell culture systems

  • Map epitopes through peptide arrays or hydrogen-deuterium exchange mass spectrometry

  • Engineer antibodies for enhanced neutralization breadth or effector functions

Peptide Inhibitor Design:

  • Identify MDV094 regions involved in receptor binding or oligomerization

  • Design peptides that mimic these regions to competitively inhibit function

  • Enhance stability through cyclization or incorporation of non-natural amino acids

  • Test in cell-based viral entry assays

Combination Approaches:
Target multiple viral glycoproteins simultaneously (MDV094 plus others) to create synergistic inhibition and reduce the likelihood of resistance development. Recombinant viruses with modifications to both MDV094 and other virulence factors could serve as experimental platforms to test combination strategies.

These methodologies provide a comprehensive framework for developing targeted interventions against GaHV-2 infection, with potential applications to other herpesvirus diseases.

How does MDV094 compare functionally to glycoprotein D in other herpesviruses like HSV-2?

A comparative analysis of MDV094 and HSV-2 glycoprotein D reveals both similarities and important differences:

Functional Parallels:
Both MDV094 and HSV-2 gD serve as critical envelope glycoproteins involved in the viral entry process. HSV-2 gD binds to specific host cell entry receptors NECTIN1 and TNFRSF14/HVEM, promoting virus entry into host cells. While the specific receptors for MDV094 aren't explicitly identified in the search results, its position as an envelope glycoprotein suggests an analogous role in receptor recognition and binding.

Structural Comparison:
HSV-2 gD is known to trigger fusion with the host membrane by recruiting the fusion machinery composed of gB and gH/gL. This function is likely conserved in MDV094, though the molecular details may differ due to host adaptation (avian versus mammalian). Both proteins belong to the broader herpesvirus glycoprotein D family, suggesting conservation of core structural elements despite sequence divergence.

Host Range Determinants:
The receptor specificity of glycoprotein D proteins is a major determinant of host range. HSV-2 gD interacts with human receptors, while MDV094 has evolved to recognize avian cellular targets. These adaptations reflect the species-specific nature of herpesvirus evolution and host-pathogen co-evolution.

Immunological Significance:
Both glycoproteins represent major targets for neutralizing antibodies, though the immunodominant epitopes likely differ. Research on HSV-2 gD has progressed further in terms of epitope mapping and antibody characterization, providing a template for similar studies with MDV094.

These comparative insights not only illuminate the biology of herpesviruses but also suggest strategies for transferring research approaches from human to veterinary herpesvirology.

What are the emerging research directions for MDV094 in understanding GaHV-2 pathogenesis and developing control strategies?

Several cutting-edge research directions for MDV094 show particular promise:

Structural Vaccinology Approaches:
The application of rational structure-based design to MDV094 represents a frontier in vaccine development. By determining the three-dimensional structure of MDV094 and mapping neutralizing epitopes, researchers can design optimized immunogens that present these epitopes more effectively. This approach could lead to next-generation vaccines with enhanced efficacy against diverse GaHV-2 strains.

CRISPR-Based Studies:
CRISPR/Cas9 technology enables precise genetic manipulation of both the virus and host. Targeted modifications to MDV094 can help map structure-function relationships, while editing of potential host receptors in chicken cells can identify critical interaction partners. The recent development of recombinant GaHV-2 with interrupted meq genes demonstrates the feasibility of genetic engineering approaches for vaccine development.

Single-Cell Analysis of Infection:
Emerging single-cell technologies allow unprecedented resolution in studying virus-host interactions. Applying these methods to MDV094-mediated entry could reveal cell population heterogeneity in susceptibility and response to infection, potentially identifying resistant cell subpopulations and their molecular signatures.

Systems Biology Integration:
Integrating MDV094 research into broader systems-level analyses of GaHV-2 infection could reveal network effects and unexpected interactions. Correlation of glycoprotein sequence variations with changes in virulence, as observed in different strains like GA, Md5, and Md11, benefits from multi-omics approaches that connect genotype to phenotype through intervening molecular networks.

One Health Perspective:
Expanding MDV094 research to include ecological and epidemiological dimensions aligns with the One Health paradigm. Understanding how glycoprotein evolution responds to vaccination pressure in poultry populations could inform sustainable disease management strategies that reduce the emergence of vaccine-resistant variants.

These research directions collectively advance our understanding of MDV094's role in GaHV-2 biology while opening new avenues for intervention and control of Marek's disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.