Recombinant Gallid herpesvirus 2 Envelope glycoprotein I (MDV095)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
gI; MDV095; Envelope glycoprotein I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-355
Protein Length
Full Length of Mature Protein
Species
Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) (GaHV-2) (Marek's disease herpesvirus type 1)
Target Names
gI
Target Protein Sequence
IVYTGTSVTLSTDQSALVAFCGLDKMVNVRGQLLFLGDQTRTSSYTGTTEILKWDEEYKC YSVLHATSYMDCPAIDATVFRGCRDAVVYAQPHDRVQPFPEKGTLLRIVEPRVSDTGSYY IRVALAGRNMSDIFRMAVIIRSSKSWACNHSASSFQAHKCIRYVDRMAFENYLIGHVGNL LDSDSELHAIYNITPQSISTDINIITTPFYDNSGTIYSPTVFNLFNNNSHVDAMNSTGMW NTVLKYTLPRLIYFSTMIVLCIIALAIYLVCERCRSPHRRIYIGEPRSDEAPLITSAVNE SFQYDYNVKETPSDVIEKELMEKLKKKVELLEREECV
Uniprot No.

Target Background

Function

In epithelial cells, the gE/gI heterodimer is essential for cell-to-cell viral spread. It facilitates the sorting of nascent virions to cell junctions, enabling rapid spread to adjacent cells via interactions with cellular receptors concentrated at these junctions. This is implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is crucial for anterograde spread of infection throughout the nervous system. In conjunction with US9, the gE/gI heterodimer plays a role in sorting and transporting viral structural components to axon terminals.

Database Links

KEGG: vg:4811454

Protein Families
Alphaherpesvirinae glycoprotein I family
Subcellular Location
Virion membrane; Single-pass membrane protein. Host cell membrane; Single-pass type I membrane protein. Host cell junction. Host Golgi apparatus membrane; Single-pass type I membrane protein.

Q&A

What is Gallid herpesvirus 2 and what role does it play in avian diseases?

Gallid herpesvirus 2 (GaHV-2) is an oncogenic α-herpesvirus that causes Marek's disease (MD), a T cell lymphosarcoma of domestic chickens. The virus belongs to the family Herpesviridae, subfamily Alphaherpesvirinae, genus Mardivirus . GaHV-2 integrates its genome into the host genome through homologous recombination and induces transformation of latently infected cells by modulating expression of viral and cellular genes . This integration and subsequent transformation make MD a unique model of viral oncogenesis.

Marek's disease causes substantial annual losses to the worldwide poultry industry, estimated at US$100 billion . The disease has increased in severity over time, with new, more virulent strains emerging that are resistant to vaccine-induced immune responses . This evolution of virulence represents a significant challenge in controlling the disease, as vaccines developed in the late 1960s and early 1970s have become less effective against emerging strains .

Phylogenetic analyses have established that GaHV-2 is more closely related to GaHV-3 (gallid herpesvirus 3) than to GaHV-1, despite all three viruses infecting chickens . This phylogenetic relationship is important for understanding the evolution and pathogenesis of avian herpesviruses.

How does envelope glycoprotein I compare structurally to other GaHV-2 glycoproteins?

GaHV-2 encodes several envelope glycoproteins that perform distinct functions during viral infection. Comparative analysis reveals both shared and unique structural features:

GlycoproteinGeneSize (aa)Key Structural FeaturesFunction
Glycoprotein IMDV095355Transmembrane domain, cytoplasmic tail with signaling motifsViral entry, cell-to-cell spread, immune evasion
Glycoprotein HMDV034813Multiple glycosylation sites, extended ectodomainMembrane fusion (with gL), essential for entry
Glycoprotein B-VariableCleaved into gp60 and gp49 fragmentsReceptor binding, fusion, immune evasion
Glycoprotein C-VariableComplement binding domainsImmune evasion, virus attachment

The analysis of orthologous glycoprotein genes across avian herpesviruses has revealed that glycoprotein H genes of GaHV-2 and turkey herpesvirus (HVT) have coding regions of 2439 and 2424 nucleotides respectively, which corresponds to proteins of 813 and 808 amino acids . Similar comprehensive analysis of glycoprotein I across different strains would provide valuable insights into its evolutionary conservation and strain-specific variations.

What are the optimal expression systems for producing recombinant MDV095?

The expression of recombinant MDV095 requires careful consideration of several factors to ensure proper folding, post-translational modifications, and biological activity. Based on research experience with similar herpesvirus glycoproteins, the following expression systems have distinct advantages and limitations:

Expression SystemAdvantagesLimitationsRecommended Protocol Elements
Bacterial (E. coli)High yield, low cost, rapid productionLack of glycosylation, potential folding issuesUse fusion tags (His, GST), solubility enhancers, refolding protocols
Insect cells (Baculovirus)Proper folding, partial glycosylationComplex system, moderate yieldOptimize codon usage, use secretion signals, screen multiple constructs
Mammalian cellsProper folding and glycosylationLower yield, higher costUse strong promoters (CMV), optimize transfection, select stable clones
Avian cellsNative-like glycosylation patternLimited scalability, specialized mediaUse chicken-derived cell lines, optimize growth conditions

For glycoproteins like MDV095 that require proper folding and post-translational modifications, eukaryotic expression systems (particularly insect or mammalian cells) are generally preferred over bacterial systems . The selection of an appropriate tag (His, FLAG, GST) during the production process facilitates purification without compromising function .

For optimal results, expression constructs should include:

  • Codon-optimized MDV095 sequence

  • Strong promoter appropriate for the chosen expression system

  • Signal sequence for proper targeting

  • C-terminal or cleavable N-terminal tag for purification

  • Protease cleavage site if tag removal is desired

Storage in Tris-based buffer with 50% glycerol at -20°C helps maintain stability, with working aliquots stored at 4°C for up to one week to avoid repeated freeze-thaw cycles .

What techniques are most effective for isolating and purifying GaHV-2 strains for MDV095 studies?

Isolating and purifying GaHV-2 field strains for MDV095 studies requires specialized techniques to separate field viruses from vaccine strains that may be present in the same samples. The following methodology has proven effective:

Step 1: Sample Preparation and In Vivo Amplification

  • Prepare cell suspensions from the spleens of MD-symptomatic chickens

  • Inoculate day-old chicks with these suspensions to amplify the virus in vivo

  • This approach reduces contamination with vaccine strains compared to direct in vitro culture

Step 2: Primary Cell Culture Isolation

  • At 2-3 weeks post-inoculation, establish primary chicken kidney (CK) cell cultures

  • Inoculate these cultures with material from the infected chicks

  • Monitor for cytopathic effects (CPE) characteristic of GaHV-2 infection

Step 3: Plaque Purification and Verification

  • Isolate individual plaques observed on CK cells

  • Passage these plaques on chicken embryo fibroblast (CEF) cells

  • Perform PCR analysis to verify the absence of vaccine strains (GaHV-3, MeHV-1) and confirm the presence of GaHV-2

This procedure is critical because direct isolation from field samples often results in isolation of vaccine strains that are adapted to in vitro culture and grow more rapidly than field strains . The plaque purification step is particularly important for ensuring that pure GaHV-2 strains are obtained for subsequent MDV095 expression and characterization studies.

How can researchers assess the functional integrity of recombinant MDV095?

Validating the functional integrity of recombinant MDV095 requires a multi-faceted approach to assess both structural integrity and biological activity:

Structural Validation:

  • SDS-PAGE and Western blotting to confirm protein size and identity

  • Glycosylation analysis using glycosidase treatments followed by mobility shift assays

  • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Mass spectrometry to verify post-translational modifications

Functional Assays:

  • Binding Assays: ELISA-based methods to test interactions with:

    • Conformation-dependent monoclonal antibodies

    • Potential cellular receptors

    • Viral or cellular protein partners

  • Cell-Based Assays:

    • Cell surface binding studies using flow cytometry

    • Cell fusion assays if MDV095 participates in membrane fusion events

    • Competitive inhibition of viral infection using recombinant MDV095

  • Virus Neutralization Tests:

    • Testing whether antibodies raised against recombinant MDV095 neutralize GaHV-2 infection

    • Determining the 50% neutralizing dose (ND50)

The purity of recombinant MDV095 preparations should exceed 85% as determined by SDS-PAGE . Proper storage in Tris-based buffer with 50% glycerol at -20°C is essential for maintaining functional integrity, and repeated freeze-thaw cycles should be avoided to prevent denaturation .

What role does MDV095 play in GaHV-2 pathogenesis and immune evasion?

The envelope glycoprotein I (MDV095) appears to be involved in multiple aspects of GaHV-2 pathogenesis, with particular implications for immune evasion. While the search results don't specifically detail MDV095's role, they provide insights about envelope glycoproteins in GaHV-2 that can be applied to understanding MDV095 function:

  • Immune Evasion Mechanisms: Viral envelope glycoproteins derived from glycoprotein B (gp60 and gp49) and glycoprotein C play roles in immune evasion . By extension, glycoprotein I (MDV095) likely contributes to similar immune evasion strategies, potentially through:

    • Interfering with complement activation

    • Masking viral epitopes from neutralizing antibodies

    • Modulating host cell surface immune recognition molecules

  • Viral Entry and Cell-to-Cell Spread: The UL49.5 gene product, another envelope protein, is essential for cell-to-cell spread in vitro . MDV095 may have similar functions in facilitating viral entry or cell-to-cell transmission, which would contribute to viral pathogenesis.

  • Integration with Host Cell Signaling: The cytoplasmic tail of MDV095 contains signaling motifs (e.g., "RSDEAPLITSAVNESFQYDYNVKETPSDV") that may interact with host cell signaling pathways to modify cellular responses to infection .

Experimental approaches to further elucidate MDV095's role could include:

  • Generation of MDV095-deletion mutants to assess effects on viral replication and pathogenesis

  • Identification of cellular interaction partners through techniques like co-immunoprecipitation

  • Analysis of MDV095 expression patterns during different phases of viral infection

How does recombination in GaHV-2 impact MDV095 evolution and function?

Homologous recombination plays a critical role in GaHV-2 evolution, with significant implications for the evolution of MDV095 and its function:

  • Recombination Mechanism: DNA replication in alphaherpesviruses is recombination-dependent, providing a mechanism for homologous recombination between genetically distinct viruses infecting the same cell . This process can impact all viral genes, including MDV095.

  • Evidence of Past Recombination Events: Analysis of the pattern of synonymous nucleotide substitution between orthologous genes shared by four GaHV-2 genomes showed strong evidence of past events of homologous recombination that homogenized certain loci between genomes . Similar recombination events likely affect the MDV095 gene.

  • Impact on Virulence Evolution: Two loci (UL49.5 and RLORF12) were found to be homogenized among virulent strains, suggesting a role in virulence . While MDV095 was not specifically identified in this category, the principle that recombination can transfer virulence-associated alleles between strains applies to all viral genes.

The consequences of recombination for MDV095 may include:

  • Introduction of novel mutations from different viral strains

  • Homogenization of the MDV095 sequence across different viral lineages

  • Combination of advantageous mutations from different strains

This recombination-driven evolution may explain why GaHV-2 continues to evolve in virulence despite vaccination efforts, potentially including changes in immune evasion functions mediated by MDV095.

What are the current approaches to studying MDV095 interactions with host cell receptors?

Studying the interactions between MDV095 and host cell receptors requires sophisticated approaches that combine molecular, cellular, and biophysical techniques:

  • Identification of Binding Partners:

    • Virus-Cell Binding Assays: Using purified MDV095 labeled with fluorescent markers to identify target cells

    • Co-immunoprecipitation: Identifying host proteins that interact with MDV095 during infection

    • Cross-linking Studies: Capturing transient interactions through chemical cross-linking followed by mass spectrometry

  • Characterization of Binding Interactions:

    • Surface Plasmon Resonance (SPR): Measuring binding kinetics and affinity constants between MDV095 and candidate receptors

    • Biolayer Interferometry (BLI): Alternative to SPR for real-time, label-free detection of molecular interactions

    • Microscale Thermophoresis (MST): Detecting interactions based on changes in thermophoretic mobility

  • Functional Validation:

    • CRISPR-Cas9 Knockout Studies: Eliminating candidate receptors to assess impact on viral entry

    • Competitive Inhibition Assays: Using soluble MDV095 or receptor fragments to block infection

    • Domain Mapping: Identifying specific regions of MDV095 involved in receptor binding through targeted mutagenesis

  • Visualization Techniques:

    • Super-resolution Microscopy: Visualizing MDV095-receptor interactions at the cell surface

    • Cryo-electron Microscopy: Determining the structure of MDV095-receptor complexes

    • Live-cell Imaging: Tracking the dynamics of MDV095-mediated entry in real-time

The establishment of lymphoblastoid cell lines (LCLs) from tumors induced by fluorescent-tagged GaHV-2, as described in search result , provides valuable tools for studying viral protein interactions with host cells, including those mediated by MDV095.

What is the potential of MDV095 as a target for vaccine development?

MDV095 represents a potential target for vaccine development against Marek's disease, with several characteristics that make it an attractive candidate:

  • Surface Exposure: As an envelope glycoprotein, MDV095 is exposed on the viral surface and accessible to neutralizing antibodies .

  • Functional Importance: If MDV095 plays essential roles in viral entry or immune evasion, antibodies targeting this protein could effectively neutralize the virus or limit its spread.

  • Conservation vs. Variation: Analysis of MDV095 sequences across different GaHV-2 strains would reveal conserved regions that could serve as broadly protective epitopes, as well as variable regions that might contribute to strain-specific immunity.

Current approaches to MDV095-based vaccine development might include:

Vaccine ApproachDescriptionAdvantagesChallenges
Subunit VaccinePurified recombinant MDV095 with adjuvantSafe, defined compositionMay require multiple doses, proper adjuvant
DNA VaccinePlasmid encoding MDV095Induces both humoral and cellular immunityLower immunogenicity in some species
Viral VectorMDV095 gene inserted into viral vector (e.g., fowlpox)Strong immunity, single dosePre-existing immunity to vector
Recombinant GaHV-2Modified GaHV-2 expressing altered MDV095Natural infection route, robust immunitySafety concerns, regulatory hurdles

The experience with recombinant GaHV-2 vaccines, such as the meq-deleted strain described in search result , provides a template for similar approaches targeting MDV095. Such a vaccine could be evaluated for its ability to protect against challenge with virulent GaHV-2 strains, with protective indices (PI) assessed as was done for the meq-deleted vaccine .

How do mutations in MDV095 correlate with GaHV-2 virulence?

While the search results don't provide specific information about mutations in MDV095 and their correlation with virulence, we can infer approaches to studying this relationship based on research with other GaHV-2 genes:

  • Comparative Genomics: Analyzing MDV095 sequences from strains with different virulence phenotypes (mild, virulent, very virulent, very virulent+) could reveal mutations associated with increased virulence .

  • Recombination Analysis: As demonstrated for other loci (UL49.5 and RLORF12), identifying recombination events that homogenize MDV095 among virulent strains would suggest a role in virulence .

  • Functional Validation: Creating recombinant viruses with specific mutations in MDV095 would allow direct testing of the impact on viral virulence in experimental infections.

  • Structure-Function Analysis: Mapping virulence-associated mutations onto the predicted structure of MDV095 could reveal functional domains important for pathogenesis.

The virulence of GaHV-2 is considered a polygenic trait, with allelic variants at multiple loci contributing to the phenotype . If MDV095 contributes to immune evasion, mutations affecting this function could potentially enhance viral persistence and pathogenesis.

A systematic analysis might include:

  • Sequencing MDV095 from historically isolated strains representing the evolution of virulence

  • Correlating specific amino acid changes with the emergence of more virulent phenotypes

  • Testing hypotheses about the functional impact of these changes using recombinant viruses

What methodological challenges exist in developing MDV095-targeted interventions?

Developing interventions targeting MDV095 faces several methodological challenges that must be addressed:

  • Antigenic Variation: GaHV-2 continuously evolves, reducing the effectiveness of existing vaccines . Understanding the extent and patterns of variation in MDV095 across field strains is essential for designing broadly protective interventions.

  • Functional Redundancy: Herpesviruses often encode multiple proteins with overlapping functions, particularly for immune evasion. Determining whether targeting MDV095 alone would be sufficient requires comprehensive functional studies.

  • In Vitro vs. In Vivo Efficacy: Evaluating MDV095-targeted interventions in vitro may not fully predict in vivo efficacy due to the complex nature of GaHV-2 pathogenesis, which involves transformation of latently infected cells .

  • Production and Purification: As a glycoprotein, recombinant MDV095 requires proper folding and post-translational modifications for biological activity, presenting challenges for large-scale production .

  • Vaccine Strain Contamination: As noted in search result , one challenge in studying field strains is the presence of vaccine strains in samples from vaccinated birds. This complicates the evaluation of MDV095-targeted vaccines in field conditions.

  • Delivery Methods: Developing effective delivery methods for MDV095-based interventions, whether as vaccines or therapeutics, requires optimization for the target tissues and infection stages.

  • Correlates of Protection: Identifying immune correlates of protection (antibody titers, T cell responses) specific to MDV095 is necessary for rational vaccine design and evaluation.

Addressing these challenges requires interdisciplinary approaches combining virology, immunology, structural biology, and vaccine technology, along with appropriate animal models for testing MDV095-targeted interventions against relevant GaHV-2 strains.

How might next-generation sequencing contribute to understanding MDV095 evolution?

Next-generation sequencing (NGS) technologies offer powerful approaches for studying MDV095 evolution across different GaHV-2 strains and during infection:

  • Comparative Genomics at Scale: NGS enables sequencing of MDV095 from numerous field isolates, providing a comprehensive view of natural variation and selective pressures.

  • Transcriptome Analysis: RNA-seq studies, similar to those described in search result , can reveal:

    • Expression patterns of MDV095 during different phases of infection

    • Co-expressed viral and cellular genes that may interact with MDV095

    • Alternative splicing or other post-transcriptional modifications

  • Evolutionary Analysis: Sophisticated bioinformatic analyses of NGS data can:

    • Identify signatures of positive selection in MDV095 sequences

    • Detect recombination events affecting the MDV095 locus

    • Track the emergence and spread of MDV095 variants in field populations

  • Deep Mutational Scanning: This technique combines NGS with functional assays to systematically assess the impact of all possible single amino acid substitutions in MDV095.

  • Metagenomics: Analyzing field samples directly without isolation can reveal the diversity of circulating strains and novel variants of MDV095.

The application of these approaches would generate comprehensive data on MDV095 evolution, potentially identifying regions under selection pressure that might be targets for intervention or regions conserved across strains that could serve as broadly protective vaccine targets.

What is known about the interactions between MDV095 and other viral glycoproteins?

The functional interactions between MDV095 and other viral glycoproteins are not specifically addressed in the search results, but general principles of herpesvirus glycoprotein interactions suggest potential areas of research:

  • Glycoprotein Complexes: In other herpesviruses, glycoproteins often function as complexes. For example, the gH/gL complex is involved in membrane fusion . MDV095 (gI) might similarly interact with other glycoproteins to form functional complexes.

  • Heterodimeric Partnerships: In alphaherpesviruses, glycoprotein I (gI) typically forms a heterodimeric complex with glycoprotein E (gE). This gE/gI complex functions in cell-to-cell spread and immune evasion through Fc receptor-like activity.

  • Fusion Machinery: Multiple glycoproteins participate in the fusion process during viral entry. Understanding how MDV095 might interact with this machinery (which typically includes gB, gH/gL) would be valuable.

  • Cooperative Immune Evasion: Given that multiple GaHV-2 glycoproteins are implicated in immune evasion , including gB-derived gp60 and gp49 as well as gC, there may be cooperative interactions between these glycoproteins and MDV095.

Experimental approaches to study these interactions could include:

  • Co-immunoprecipitation studies to identify physical interactions

  • Functional complementation assays with glycoprotein-knockout viruses

  • Structural studies of glycoprotein complexes

  • Competitive binding assays to identify overlapping functions

Understanding these interactions could reveal synergistic functions and provide insights for designing interventions that target multiple glycoproteins simultaneously.

How could structural biology approaches enhance our understanding of MDV095 function?

Structural biology approaches would provide invaluable insights into MDV095 function and inform rational design of interventions:

  • High-Resolution Structure Determination:

    • X-ray crystallography of the MDV095 ectodomain

    • Cryo-electron microscopy of full-length MDV095 in the membrane

    • NMR spectroscopy of specific domains or peptide fragments

  • Functional Domain Mapping:

    • Identifying receptor-binding domains

    • Locating antibody-binding epitopes

    • Characterizing transmembrane and cytoplasmic regions

  • Molecular Dynamics Simulations:

    • Modeling conformational changes during receptor binding

    • Predicting effects of mutations on protein stability and function

    • Simulating interactions with lipid bilayers

  • Structure-Guided Mutagenesis:

    • Designing point mutations to test functional hypotheses

    • Creating chimeric proteins to map domain-specific functions

    • Engineering modifications to enhance immunogenicity

  • Comparative Structural Analysis:

    • Comparing MDV095 with glycoprotein I from other herpesviruses

    • Identifying conserved structural features across strains

    • Recognizing unique structural elements that might contribute to GaHV-2 pathogenesis

The resulting structural information would facilitate:

  • Rational design of antibodies targeting functional epitopes

  • Development of small-molecule inhibitors of MDV095 function

  • Structure-based vaccine design focusing on protective epitopes

  • Understanding the mechanistic basis of immune evasion

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.