Recombinant Gallid herpesvirus 2 Protein UL20 homolog (MDV032)

Shipped with Ice Packs
In Stock

Description

Functional Role in Viral Pathogenesis

MDV032 is indispensable for critical stages of the viral life cycle:

Viral Egress and Cytoplasmic Envelopment

MDV032 facilitates the transport of viral particles from the nucleus to the cytoplasm, a process requiring coordination with other structural proteins. Its interaction with the glycoprotein gK is essential for:

  • Intracellular transport: Ensuring gK reaches the cell surface .

  • Glycosylation: Maintaining gK’s proper post-translational modification .

  • Envelopment: Enabling virion assembly in the cytoplasmic compartment .

Modulation of Virus-Induced Cell Fusion

MDV032 regulates cell fusion mediated by glycoprotein B (gB), a process critical for spreading infection. By forming a complex with gK, MDV032 fine-tunes fusion efficiency, balancing viral dissemination with host cell integrity . This dual role in promoting and modulating fusion underscores its evolutionary significance.

FunctionMechanism
EgressFacilitates nuclear-to-cytoplasmic transport via gK interaction
EnvelopementCoordinates virion assembly in cytoplasmic vesicles
Fusion RegulationModulates gB-mediated fusion through gK complex formation

Genomic Localization

MDV032 is encoded within the unique long (UL) genome region of GaHV-2, colinear with the UL20 homolog in herpes simplex virus type 1 (HSV-1) . Its genomic arrangement mirrors that of other alphaherpesviruses, suggesting conserved evolutionary pressures .

Transcriptional Regulation

RNA transcripts for MDV032 have been detected in infected cells, though its expression timing (early vs. late) remains unclear . Unlike the UL21 homolog in MDV2, which lacks detectable transcripts, MDV032 is actively transcribed, indicating a functional role in productive infection .

Homology and Divergence

Comparative analysis reveals:

VirusUL20 HomologHomology Level
Gallid herpesvirus 2MDV032Baseline (reference)
Herpes simplex virus 1UL20Low
Human cytomegalovirusUL20Moderate
Varicella-zoster virusORF22Variable

This low homology suggests MDV032 may have evolved unique adaptations for avian hosts, though functional conservation across alphaherpesviruses is maintained .

Recombinant Protein Production

MDV032 is commercially available as a recombinant protein purified from bacterial systems. Key features include:

ParameterSpecification
Quantity50 µg (custom quantities available)
BufferTris-based buffer with 50% glycerol
Storage-20°C (stable for long-term storage)

The protein is typically untagged, though tags may be added during production depending on experimental requirements .

Experimental Uses

  1. ELISA Development: Serves as an antigen for detecting anti-MDV antibodies in poultry .

  2. Protein Interaction Studies: Used to map binding sites with gK or gB .

  3. Vaccine Research: Explored as a subunit vaccine candidate due to its immunogenicity .

Comparative Analysis with Other Herpesviral UL20 Homologs

While MDV032 shares functional roles with UL20 homologs in other herpesviruses, structural and evolutionary differences highlight its uniqueness:

FeatureMDV032HSV-1 UL20HCMV UL20
Amino Acid Length234 aa~200 aa~200 aa
gK InteractionEssential for transportCritical for fusionRequired for virion release
Fusion ModulationRegulates gB activityDirectly involved in fusionIndirectly via gH/gL

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type in mind, please inform us, and we will prioritize the development of your specified tag.
Synonyms
MDV032; Protein UL20 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) (GaHV-2) (Marek's disease herpesvirus type 1)
Target Names
MDV032
Target Protein Sequence
MSKHGFGYYATEANEYTIPLDDIDDGRSDTDAKTLGSVLTQLSEEVDWDDAVDYATMSSY LGDYVFTIPNSYDIHPKFTRYVVLFGLSTFVLRPSCCLIFLFYAIYAQDNRFLILGTTIT AFFYGTLMLEMYYMYANIKYDLMPLSKFQQVLIGALSMLGPIIFVAISYNMIFKDVTFMK KILAFDTNLKTSGFVIYLVMIASLAYSITSISDAIGFLLPRLWTRAVLKSCVPF
Uniprot No.

Target Background

Function
Recombinant Gallid herpesvirus 2 Protein UL20 homolog (MDV032) plays a crucial role in the egress of virus particles from the nucleus, cytoplasmic envelopment, and virus-induced cell fusion. It forms a functional protein complex with gK, and this interaction is essential for their coordinated intracellular transport, gK glycosylation, expression on the host cell surface, and function. Together, they modulate gB-mediated virus-induced cell fusion and virion egress, actively participating in these processes.
Database Links

KEGG: vg:4811493

Protein Families
Alphaherpesvirinae UL20 family
Subcellular Location
Virion. Host cell membrane; Multi-pass membrane protein. Host endosome membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host nucleus membrane; Multi-pass membrane protein.

Q&A

What is Gallid herpesvirus 2 Protein UL20 homolog and its significance in research?

Gallid herpesvirus 2 (GaHV-2) Protein UL20 homolog, encoded by the MDV032 gene, is a viral protein from Marek's disease virus type 1 (MDV-1), an oncogenic α-herpesvirus that infects chickens. This protein is significant in research because it comes from a virus that serves as an important model for virus-induced oncogenesis. GaHV-2 is commonly known as Marek's disease virus type 1, and the virulent strains cause lymphoproliferative disease in susceptible birds .

The UL20 homolog protein consists of 234 amino acids and plays potential roles in viral assembly and egress from infected cells. Understanding this protein's structure and function contributes to our knowledge of herpesvirus pathogenesis and may lead to improved control strategies for Marek's disease, which remains a significant economic concern in the poultry industry worldwide.

What are the optimal storage and handling conditions for recombinant MDV032?

For optimal research outcomes, recombinant MDV032 protein requires specific storage and handling conditions:

ParameterRecommended ConditionNotes
Storage bufferTris-based buffer, 50% glycerolOptimized for this protein
Short-term storage4°CUp to one week
Long-term storage-20°CStandard storage
Extended storage-20°C or -80°CFor maximum stability
Freeze-thaw cyclesMinimizeRepeated freezing and thawing is not recommended

These storage recommendations are critical for maintaining protein stability and activity . When designing long-term studies, consider preparing aliquots upon receipt to minimize freeze-thaw cycles. Working aliquots can be maintained at 4°C for up to one week to preserve protein integrity while conducting experiments.

What experimental designs are most appropriate for studying MDV032 in viral pathogenesis?

When investigating MDV032's role in viral pathogenesis, several quasi-experimental designs (QEDs) offer advantages for different research questions:

  • Pre-Post Designs with Non-Equivalent Control Groups: This approach is useful for comparing MDV032 wild-type versus mutant effects in different cell or animal populations. The design involves comparison of those receiving the intervention (e.g., cells expressing wild-type MDV032) with those not receiving it or receiving a mutant version .

  • Interrupted Time Series Design: When studying the temporal effects of MDV032 expression on cellular processes, this design allows researchers to collect multiple observations before and after introducing the protein, enabling detection of both immediate and gradual effects while controlling for pre-existing trends .

  • Stepped Wedge Design: Particularly valuable for in vivo studies, this design allows for the staggered implementation of MDV032-related interventions across different groups, with all groups eventually receiving the intervention. This minimizes ethical concerns while maximizing statistical power .

To enhance internal validity, researchers should implement strategies such as consistent sampling across control sites, collection of additional supporting data, and careful selection of appropriate control groups that match experimental conditions as closely as possible .

How can researchers effectively use recombinant MDV032 in immunological studies?

For immunological studies, recombinant MDV032 can be effectively employed in multiple applications:

  • ELISA-Based Detection: The recombinant protein can serve as a standard antigen in enzyme-linked immunosorbent assays to detect and quantify antibodies against GaHV-2 in research samples .

  • Antibody Production: Recombinant MDV032 can be used to generate specific antibodies for immunological studies, including immunohistochemistry, Western blotting, and immunoprecipitation.

  • T-Cell Response Analysis: Researchers can use the purified protein to stimulate T-cells in vitro to evaluate cell-mediated immunity against GaHV-2.

  • Vaccine Development Research: As a component in experimental vaccine formulations, the recombinant protein can help evaluate protective immune responses.

When designing these immunological experiments, consider potential cross-reactivity with other herpesvirus proteins and include appropriate controls to ensure specificity of observed immune responses.

What molecular techniques are recommended for analyzing protein-protein interactions involving MDV032?

To investigate protein-protein interactions involving MDV032, researchers should consider these methodologically rigorous approaches:

  • Co-Immunoprecipitation (Co-IP): Using antibodies against MDV032 or putative interaction partners to pull down protein complexes from infected cells or transfected systems.

  • Yeast Two-Hybrid Screening: For identifying novel interaction partners of MDV032, particularly when studying its role in viral assembly.

  • Proximity Ligation Assays (PLA): To visualize and quantify protein interactions in situ within cells.

  • Bimolecular Fluorescence Complementation (BiFC): For validating direct interactions and determining their subcellular localization.

  • Mass Spectrometry-Based Approaches: To identify entire interactomes of MDV032 in different cellular contexts or during different stages of viral infection.

When designing these experiments, it's critical to include appropriate controls such as non-interacting protein pairs and to validate findings using multiple complementary techniques to ensure reproducibility and reliability.

How can researchers address contradictory data when studying MDV032's role in the viral lifecycle?

When confronting contradictory data regarding MDV032's function, researchers should implement a systematic approach:

  • Methodological Triangulation: Employ multiple experimental techniques to study the same phenomenon. For example, combine genetic approaches (knockout/knockdown) with biochemical and imaging methods to build a more comprehensive understanding of MDV032 function.

  • Contextual Analysis: Evaluate whether contradictions arise from differences in experimental conditions. Document and systematically vary parameters such as:

    • Cell types and their activation states

    • Viral strains (laboratory vs. field isolates)

    • Timing of observations during infection cycle

    • Protein expression levels

  • Meta-Analysis Framework: When published studies show contradictory results, systematically analyze differences in:

    • Experimental designs and controls

    • Reagents used (antibodies, constructs)

    • Data analysis methods

    • Sample sizes and statistical approaches

  • Hybrid-PCR Approach: As demonstrated in research on GaHV-2 miRNAs, hybrid-PCR can be used to identify target interactions of MDV032, which may help resolve conflicting data about its function .

  • Bacterial Artificial Chromosome (BAC) Mutagenesis: Create specific mutations in MDV032 to test hypotheses about which domains are responsible for contradictory observations, similar to approaches used for studying GaHV-2 miRNAs .

What approaches can be used to study the relationship between MDV032 and viral miRNAs in GaHV-2 pathogenesis?

Recent research has highlighted important connections between GaHV-2 proteins and viral miRNAs in oncogenesis. To study potential relationships between MDV032 and viral miRNAs:

  • Deletion Mutant Analysis: Generate MDV032 deletion mutants using bacterial artificial chromosome (BAC) mutagenesis techniques, similar to those used to study miR-M2's role in GaHV-2 pathogenesis .

  • Target Prediction and Validation: Use hybrid-PCR approaches to identify whether MDV032 mRNA is targeted by viral miRNAs, or whether MDV032 protein influences miRNA processing or function .

  • Correlation Studies: Analyze the expression patterns of MDV032 and viral miRNAs during different stages of infection and transformation to identify potential regulatory relationships.

  • Functional Recovery Experiments: In MDV032 deletion mutants, test whether specific viral miRNAs (like miR-M2-5p or miR-M4-5p) can complement the loss of MDV032 function, or vice versa.

  • Pathway Analysis: Investigate whether MDV032 and specific viral miRNAs (like miR-M2-5p) target overlapping cellular pathways by examining effects on common host targets such as RBM24, MYOD1, or RAC1 .

This integrated approach can reveal whether MDV032 and viral miRNAs work cooperatively or antagonistically in the viral life cycle and oncogenesis.

What methodologies are appropriate for investigating the role of MDV032 in viral-induced oncogenesis?

To investigate MDV032's potential role in GaHV-2 oncogenesis, researchers should consider these methodologically rigorous approaches:

  • Comparative Oncogenomics: Compare MDV032 sequence and expression between oncogenic and non-oncogenic strains of GaHV-2 to identify correlation with oncogenic potential.

  • Transformation Assays: Evaluate the effect of MDV032 expression on cellular transformation in vitro using focus formation assays, soft agar colony formation, and assessment of anchorage-independent growth.

  • Animal Models: Utilize the natural host (chickens) infected with wild-type versus MDV032-mutant viruses to assess differences in tumor formation, metastasis, and survival rates.

  • Signaling Pathway Analysis: Investigate MDV032's impact on key oncogenic signaling pathways, particularly those known to be dysregulated in MDV-induced lymphomas.

  • Transcriptomic and Proteomic Profiling: Compare global gene and protein expression patterns in cells expressing MDV032 versus controls to identify downstream effectors.

  • Integration with miRNA Studies: Given the importance of viral miRNAs like miR-M2 in GaHV-2 oncogenesis, investigate potential functional relationships between MDV032 and these regulatory molecules .

When designing these experiments, researchers should implement a stepped wedge design or pre-post design with non-equivalent control groups to strengthen causal inference regarding MDV032's oncogenic properties .

What quality control parameters should be evaluated when working with recombinant MDV032 protein?

Quality ParameterMethodAcceptance Criteria
PuritySDS-PAGE>90% single band
IdentityWestern blot/Mass spectrometryConfirmation of MDV032 sequence
ConcentrationBradford/BCA assayMatches certificate of analysis
ActivityFunctional assay relevant to research aimsApplication-dependent
Endotoxin levelsLAL assay<1.0 EU/μg protein
Aggregation stateDynamic light scatteringPrimarily monodisperse

Additionally, researchers should verify protein stability under their specific experimental conditions, as the recommended storage in Tris-based buffer with 50% glycerol may need to be adjusted depending on the application .

How can researchers optimize experimental conditions when studying MDV032 interactions with host cellular components?

When investigating MDV032 interactions with host cellular components, optimization of experimental conditions is critical:

  • Buffer Optimization: Start with the storage buffer (Tris-based with 50% glycerol) but optimize salt concentration, pH, and additives to maintain protein stability while facilitating interactions .

  • Expression System Selection: Choose expression systems that allow for proper folding and post-translational modifications of MDV032, considering both prokaryotic and eukaryotic options depending on the research question.

  • Interaction Kinetics: Determine optimal incubation times and temperatures through systematic time-course experiments to capture both transient and stable interactions.

  • Detection Method Validation: For each interaction study, validate detection methods using known controls to establish sensitivity and specificity thresholds.

  • Cellular Context Considerations: When possible, conduct experiments in relevant cell types (chicken B lymphocytes or fibroblasts) to accurately reflect the natural environment of MDV032 function.

To enhance internal validity when comparing different experimental conditions, implement a pre-post design with non-equivalent control groups or an interrupted time series approach to account for variability across experimental setups .

What bioinformatic approaches are valuable for predicting MDV032 function and interactions?

Bioinformatic analysis can provide valuable insights into MDV032 function prior to experimental validation:

  • Sequence-Based Analysis:

    • Homology modeling based on the UL20 protein from related herpesviruses

    • Identification of conserved domains and motifs across alphaherpesvirus UL20 homologs

    • Prediction of post-translational modification sites

  • Structural Prediction:

    • Transmembrane domain prediction tools to refine understanding of MDV032 topology

    • Ab initio or template-based 3D structure prediction

  • Interaction Prediction:

    • Protein-protein interaction prediction based on structural features

    • Assessment of potential binding sites for cellular factors

    • Integration with known interactome data from related viral proteins

  • Functional Network Analysis:

    • Pathway enrichment of predicted interaction partners

    • Integration with host gene expression data during infection

    • Comparison with functional networks of homologous proteins

  • Evolutionary Analysis:

    • Selective pressure analysis to identify functionally important residues

    • Comparative analysis across GaHV-2 strains of varying virulence

These predictive approaches should be used to generate testable hypotheses that can then be validated through the experimental methods discussed in previous sections.

What emerging technologies show promise for advancing understanding of MDV032 function?

Several cutting-edge technologies offer significant potential for deepening our understanding of MDV032:

  • CRISPR-Cas9 Gene Editing: For precise modification of MDV032 in the viral genome, enabling functional studies of specific domains or residues without disrupting the entire protein.

  • Single-Cell Technologies: Application of single-cell RNA-seq and proteomics to understand cell-to-cell variability in MDV032 expression and function during infection and transformation.

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize MDV032 localization during different stages of viral infection

    • Live-cell imaging combined with fluorescently tagged MDV032 to track dynamics in real-time

  • Cryo-Electron Microscopy: To determine high-resolution structures of MDV032 alone or in complex with interaction partners.

  • Systems Biology Approaches: Integration of multi-omics data to place MDV032 within the broader context of virus-host interactions and oncogenic transformation.

When implementing these technologies, researchers should carefully design experiments using appropriate quasi-experimental designs to maximize internal validity while maintaining relevance to biological processes .

How might research on MDV032 contribute to broader understanding of herpesvirus pathogenesis?

Research on MDV032 has significant implications for understanding fundamental aspects of herpesvirus biology:

  • Comparative Virology: As a UL20 homolog, MDV032 research provides insights into conserved mechanisms of herpesvirus assembly and egress across different viral species.

  • Virus-Induced Oncogenesis: GaHV-2 is one of the few direct oncogenic herpesviruses, making MDV032 studies potentially valuable for understanding how herpesvirus proteins contribute to cellular transformation.

  • Host-Adaptation Mechanisms: Comparing MDV032 with UL20 homologs from other herpesviruses can reveal how these proteins have evolved to function in different hosts and cell types.

  • Viral miRNA Interactions: Investigation of potential functional relationships between MDV032 and viral miRNAs like miR-M2 could uncover novel regulatory mechanisms in herpesvirus biology .

  • Therapeutic Target Identification: Understanding MDV032's role in viral replication and pathogenesis may reveal new targets for antiviral development against herpesviruses more broadly.

When designing studies to address these broader implications, researchers should implement stepped wedge designs or pre-post designs with appropriate controls to strengthen causal inference and maximize external validity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.