Recombinant Gallid herpesvirus 2 Virion egress protein UL34 homolog (MDV047)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Gallid herpesvirus 2 Virion Egress Protein UL34 Homolog (MDV047)

Recombinant Gallid herpesvirus 2 Virion egress protein UL34 homolog (MDV047) refers to a protein derived from Gallid herpesvirus 2 (GaHV-2), also known as Marek's disease virus (MDV) . MDV047 is a homolog of the herpes simplex virus (HSV) UL34 protein and is involved in the egress of virions from the nucleus during viral replication . Specifically, MDV047 is a viral protein that plays a crucial role in the primary envelopment of nucleocapsids, a necessary step for the virus to exit the host cell's nucleus .

Key Features and Characteristics

  • Nomenclature: Also referred to as Virion egress protein UL34 homolog or Primary envelopment factor UL34 .

  • Origin: Derived from Gallid herpesvirus 2 (GaHV-2), specifically strain Chicken/Md5/ATCC VR-987 .

  • Function: Facilitates the egress of herpesvirus nucleocapsids from the nucleus, which is essential for viral replication and spread .

  • Homology: Exhibits significant similarity to the UL34 protein of herpes simplex virus type 1 (HSV-1) . UL34 proteins are conserved among herpesviruses .

  • Structural Features: UL34 homologs contain an amino-terminal domain responsible for vesicle formation through interactions with UL31 homologs. The carboxy-terminal domain varies in length and does not form well-defined secondary structures .

Functional Significance in Viral Replication

The UL34 protein family, including MDV047, is crucial for herpesvirus replication. These proteins form a complex with UL31 homologs, which localizes to the nuclear rim and mediates the primary envelopment of nucleocapsids . This envelopment process is essential for the virus to bud from the inner nuclear membrane and move towards the cytoplasm .

Interaction with UL31 Homologs

UL34 proteins interact with UL31 proteins to form a complex necessary for the egress of herpesvirus nucleocapsids from the nucleus . The binding site of UL34 for UL31 is located within the first conserved region (CR1) of UL31 proteins . This interaction is highly conserved among different herpesvirus subfamilies .

Role in Horizontal Transmission

The UL34 homolog is essential for the horizontal transmission of Marek's Disease Virus (MDV) . Horizontal transmission refers to the spread of the virus from one host to another through direct or indirect contact .

Involvement of ESCRT-III Machinery

UL34 homologs, like MDV047, contain disordered domains that mediate interactions with the ESCRT-III machinery . The ESCRT-III machinery is involved in the nuclear egress of Epstein-Barr virus (EBV), and UL34 homologs play a role in recruiting ESCRT-III to the inner nuclear membrane (INM) for efficient primary envelopment .

Experimental Data on UL34 Mutants

Studies involving UL34 mutants have provided insights into the protein's function. For example, mutations in the arginine cluster within the disordered domain of HSV-1 UL34 affect the interaction with ALIX, a protein involved in recruiting ESCRT-III .
The table below summarizes the effects of UL34 mutations on HSV-1 virion morphogenesis:

Cell typeNucleocapsids in the nucleusEnveloped virions in the perinuclear spaceNucleocapsids in the cytoplasmEnveloped virions in the cytoplasmExtracellular enveloped virionsTotal (particles/cells)
HSV-1(F)63.0 ± 12.4 (731)2.4 ± 1.0 (26)7.8 ± 3.1 (91)4.0 ± 2.0 (47)22.8 ± 4.6 (265)1161/14
Strep-UL3454.6 ± 10.8 (678)5.9 ± 2.4 (73)8.5 ± 3.4 (106)5.3 ± 2.2 (65)25.8 ± 4.1 (320)1242/14
Strep-UL34R6D66.2 ± 12.2 (1064)19.5 ± 4.0 (314)3.4 ± 1.4 (54)1.0 ± 0.7 (16)10.0 ± 2.5 (160)1608/14
Strep-UL34R6D-rep50.4 ± 14.4 (746)5.7 ± 3.3 (85)9.5 ± 3.2 (141)5.7 ± 2.0 (85)28.6 ± 6.5 (424)1481/14

These results indicate that mutations in the UL34 arginine cluster can disrupt the normal distribution of viral particles during morphogenesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your needs.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NEC2; MDV047; Nuclear egress protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-277
Protein Length
full length protein
Species
Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) (GaHV-2) (Marek's disease herpesvirus type 1)
Target Names
NEC2
Target Protein Sequence
MEVIPNINSRRAGLIARIKLIVRGDLTTGNYDPVLAESFSGCIPTRSAFQFSGADGVESA FPVEYVMRMMNDWAKGECNPYIKIQNTGVSVLIEGFFDPPINATKAPLCTDKVNVLLNTT ESTGIVLSDINKIKQSIGVDCRPFQACLIVNCFVRLPIVQLAFRFVGPSDPGRTTKLLDS AIAAYDAKIRQRRKRNLQIMESKSQDHTSDGCIPIPIIDETHRSGITGESKSLFGMFKNI ASGECVTTIRIPRYIVMLWIFSVLLAMVTWGSYRLYS
Uniprot No.

Target Background

Function

This protein plays a crucial role in virion nuclear egress, the initial step of viral release. Within the host cell nucleus, it interacts with the newly formed capsid via its vertices, guiding it to the inner nuclear membrane through its association with NEC2. It induces capsid budding at the inner nuclear membrane and subsequent envelopment within the perinuclear space. The protein complex then facilitates fusion of the enveloped capsid with the outer nuclear membrane, releasing the viral capsid into the cytoplasm for secondary budding at Golgi or trans-Golgi network sites.

Database Links

KEGG: vg:4811507

Protein Families
Herpesviridae NEC2 protein family
Subcellular Location
Host nucleus inner membrane; Single-pass membrane protein.

Q&A

What is Gallid herpesvirus 2 Virion egress protein UL34 homolog (MDV047)?

The MDV047 protein is a virion egress protein UL34 homolog encoded by Gallid herpesvirus 2 (GaHV-2), also known as Marek's disease virus (MDV). It functions as a primary envelopment factor during viral replication . The protein is encoded by the MDV047 gene in the Md5 strain of MDV, which has been fully sequenced and characterized as a highly virulent strain causing oncogenic disease in chickens . The UL34 homolog is part of the nuclear egress complex that mediates the exit of viral nucleocapsids from the nucleus during viral replication. This protein has a full sequence length of 277 amino acids and has been identified as one of the conserved proteins across alphaherpesviruses, though with specific adaptations in MDV .

What experimental methods are optimal for expressing and purifying recombinant MDV047?

For optimal expression and purification of recombinant MDV047, several methodological approaches have proven effective:

  • Expression System Selection: Bacterial expression systems (E. coli BL21) are suitable for producing the protein in moderate quantities, but insect cell expression systems (Sf9 or High Five cells with baculovirus vectors) produce higher yields with proper folding and post-translational modifications.

  • Construct Design: The following considerations are critical:

    • Include a suitable tag (His6, GST, or MBP) for purification

    • Express the full sequence (277 amino acids) while avoiding the transmembrane region if solubility issues arise

    • Optimize codon usage for the chosen expression system

  • Purification Protocol: A multi-step purification process yields the best results:

    • Initial capture using affinity chromatography (based on the tag used)

    • Secondary purification using ion-exchange chromatography

    • Final polishing step with size-exclusion chromatography

    • Storage in Tris-based buffer with 50% glycerol as recommended for commercial preparations

  • Quality Control: Assess purity using SDS-PAGE and Western blotting, and confirm proper folding through circular dichroism spectroscopy.

For researchers investigating protein-protein interactions, maintaining the native conformation is crucial, which may necessitate the use of mammalian expression systems such as HEK293 cells.

How do UL34 homologs differ between MDV and other herpesviruses?

Comparative analyses reveal several significant differences between UL34 homologs in MDV and other herpesviruses:

  • Sequence Divergence: While the UL34 core functional domain is conserved, MDV UL34 shows considerable sequence divergence from mammalian herpesvirus homologs, reflecting host adaptation to avian species .

  • Expression Patterns: Unlike many mammalian herpesviruses where membrane proteins remain embedded in cellular membranes, MDV shows a tendency for secretion of membrane-associated proteins, as demonstrated with glycoprotein C (UL44) . This pattern may extend to other membrane-associated proteins including UL34.

  • Functional Partners: The nuclear egress complex in MDV likely involves virus-specific protein interactions that differ from those in human alphaherpesviruses like HSV-1.

  • Genomic Context: In the MDV genome, UL34 exists within a highly conserved block of genes in the unique long (UL) region, maintaining synteny with other alphaherpesviruses, but the regulatory elements controlling expression may differ .

The distinctions between MDV UL34 and its homologs in other herpesviruses provide valuable insights into virus-host adaptation and may explain some of the unique pathogenic properties of MDV in avian hosts.

What approaches are most effective for studying UL34-mediated protein-protein interactions?

To effectively study UL34-mediated protein-protein interactions in MDV, researchers should consider these methodological approaches:

  • Yeast Two-Hybrid (Y2H) Screening:

    • Advantages: High-throughput identification of potential interacting partners

    • Limitations: May produce false positives and cannot detect interactions requiring specific cellular context

    • Implementation: Using UL34 as bait against a chicken cDNA library can identify novel interactions

  • Co-Immunoprecipitation (Co-IP):

    • Advantages: Detects interactions in a near-native cellular environment

    • Implementation: Express tagged versions of UL34 in chicken cell lines (e.g., DF-1) infected with MDV

    • Verification: Western blotting with antibodies against suspected partner proteins

  • Proximity Labeling Methods:

    • BioID or APEX2 fused to UL34 enables identification of proteins in close proximity within living cells

    • Particularly useful for identifying transient interactions during different stages of viral infection

  • Fluorescence Resonance Energy Transfer (FRET):

    • For confirming direct interactions and determining their subcellular localization

    • Useful for visualizing dynamic interactions during viral replication in real-time

  • Surface Plasmon Resonance (SPR):

    • For characterizing binding kinetics and affinities of purified recombinant proteins

    • Provides quantitative data on association and dissociation rates

When designing these experiments, researchers should consider the challenges posed by the membrane-associated nature of UL34 and potential species-specific interactions that may occur in the avian cellular environment.

What cell culture systems are most appropriate for studying MDV047 function?

The selection of appropriate cell culture systems is critical for studying MDV047 function:

  • Primary Chicken Embryo Fibroblasts (CEFs):

    • Gold standard for MDV propagation and functional studies

    • Closely mimics natural host cells

    • Used in the isolation and propagation of the Md5 strain of MDV

    • Limitation: Batch-to-batch variation and limited lifespan

  • Immortalized Avian Cell Lines:

    • DF-1 (immortalized chicken fibroblast line): Supports MDV replication

    • LMH (chicken hepatocellular carcinoma): Useful for protein expression studies

    • Advantages: Consistent characteristics and unlimited passage potential

  • Feather Follicle Epithelial (FFE) Cells:

    • Most relevant for studying late stages of infection and virus shedding

    • Essential for viral transmission studies

    • Challenging to culture in vitro, often requiring specialized techniques or explant cultures

  • Lymphoid Cell Lines:

    • Critical for studying transformation and oncogenicity

    • Examples: MSB-1, MDV-transformed lymphoblastoid cell lines

    • Important for understanding UL34's role in different phases of MDV infection

Research questions focused on basic viral replication mechanisms can use CEFs or DF-1 cells, while studies on viral pathogenesis and cell-type specific functions of UL34 may require more specialized systems such as lymphoid cells or ex vivo chicken tissues .

How can CRISPR-Cas9 technology be applied to investigate UL34 function in MDV?

CRISPR-Cas9 technology offers powerful approaches for investigating UL34 function in MDV:

  • Gene Editing Strategies:

    • Complete UL34 knockout: To establish essentiality for viral replication

    • Domain-specific mutations: To determine functional regions without eliminating the entire protein

    • Insertion of reporter tags: For real-time visualization of UL34 trafficking

  • Experimental Workflow:

    • Design of specific sgRNAs targeting MDV047 gene regions

    • Introduction of CRISPR-Cas9 components along with homology-directed repair templates into cells harboring the MDV genome

    • Screening and isolation of edited viral genomes

    • Phenotypic characterization of mutant viruses

  • Technical Considerations:

    • Use of bacterial artificial chromosome (BAC) clones of MDV for easier manipulation

    • Implementation of two-step Red-mediated mutagenesis similar to techniques used for other MDV genes

    • Inclusion of selection markers for efficient identification of recombinants

    • Confirmation by restriction fragment length polymorphism (RFLP) analysis, analytical PCR, and DNA sequencing

  • Readout Systems:

    • Plaque morphology and size analysis

    • Growth kinetics in various cell types

    • Visualization of subcellular localization using fluorescence microscopy

    • Transmission electron microscopy to observe nuclear egress defects

This approach allows for precise manipulation of UL34 and assessment of its contribution to viral replication, providing insights that would be difficult to obtain through traditional methods.

What structural biology techniques provide the most valuable insights into UL34 homolog structure?

Multiple structural biology techniques offer complementary insights into UL34 homolog structure:

  • X-ray Crystallography:

    • Provides atomic-level resolution of protein structure

    • Challenges: Requires protein crystallization, which can be difficult for membrane-associated proteins

    • Solution: Expression and purification of soluble domains excluding transmembrane regions

  • Cryo-Electron Microscopy (Cryo-EM):

    • Advantages: Can visualize larger complexes and doesn't require crystallization

    • Particularly valuable for studying UL34 in the context of the nuclear egress complex

    • Resolution has improved significantly in recent years, approaching that of X-ray crystallography

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Best for studying protein dynamics and ligand interactions

    • Limited to smaller proteins or domains (typically <30 kDa)

    • Useful for characterizing flexible regions and binding interfaces

  • Small-Angle X-ray Scattering (SAXS):

    • Provides low-resolution structural information in solution

    • Advantages: No size limitations and proteins can be studied in near-native conditions

    • Useful as a complementary technique to other structural methods

  • Computational Approaches:

    • Homology modeling based on structures of UL34 homologs from other herpesviruses

    • Molecular dynamics simulations to predict protein behavior in different environments

    • Integration with experimental data for validation and refinement

For MDV047 specifically, a multi-technique approach combining soluble domain crystallography with computational modeling of the full-length protein would likely yield the most comprehensive structural insights.

How does UL34 homolog contribute to MDV virulence and oncogenicity?

The contribution of UL34 homolog to MDV virulence and oncogenicity involves several interconnected mechanisms:

  • Efficient Viral Replication:

    • As a nuclear egress protein, UL34 facilitates efficient production of viral particles

    • Higher viral loads correlate with enhanced pathogenicity and tumor development in MDV infection

    • Efficient replication in lymphoid tissues is particularly relevant for oncogenic transformation

  • Interaction with Host Defense Mechanisms:

    • UL34 may modulate host cell apoptotic responses during infection

    • Nuclear membrane restructuring during egress could affect cellular signaling pathways

    • These interactions may contribute to the survival of infected cells, potentially promoting transformation

  • Cooperative Effects with Oncogenic Viral Proteins:

    • While UL34 itself is not directly oncogenic, it functions in concert with known MDV oncoproteins

    • The Md5 strain, which contains UL34, exhibits very virulent phenotype, consistent with only two copies of the 132-bp repeat, a genomic feature associated with virulence

    • Context within the viral genome: UL34 functions within a complex genetic background that includes established oncogenes like MEQ, pp38, and pp24

  • Cell-Type Specific Effects:

    • UL34's impact likely varies across different infected cell types

    • In lymphocytes, efficient viral replication facilitated by UL34 may promote cellular transformation

    • In feather follicle epithelium, UL34-mediated efficient virus production enhances transmission

While direct evidence linking UL34 to oncogenicity is limited, its essential role in the viral life cycle makes it an integral component of the pathogenic process that ultimately leads to tumor formation in susceptible hosts.

Can UL34 be targeted for antiviral therapy against Marek's disease?

UL34 presents several characteristics that make it a promising target for antiviral therapy against Marek's disease:

  • Target Validation Considerations:

    • Essential role in viral replication: As a nuclear egress protein, UL34 is likely critical for productive infection

    • Conservation across MDV strains: Suggests limited ability to mutate without losing function

    • Distinct from host proteins: Minimizes potential off-target effects on host cells

  • Therapeutic Approaches:

    • Small molecule inhibitors: Compounds that disrupt UL34 function or its interaction with other viral proteins

    • Peptide-based inhibitors: Designed to interfere with specific protein-protein interactions involving UL34

    • RNA interference: siRNAs targeting MDV047 mRNA to reduce protein expression

  • Delivery Challenges in Avian Systems:

    • In-ovo vaccination: Potential for delivery of antiviral compounds before hatching

    • Feed-based delivery: Incorporation of stable inhibitors into poultry feed

    • Viral vector delivery: Use of attenuated viruses to deliver therapeutic molecules

  • Combinatorial Approaches:

    • UL34 inhibitors combined with vaccines for enhanced protection

    • Targeting multiple viral proteins simultaneously to reduce resistance development

    • Integration with immune modulators to enhance host response

The development of UL34-targeted antivirals would require extensive in vitro validation followed by in vivo testing in chicken models, with careful assessment of efficacy, safety, and potential for resistance development. The economic importance of controlling Marek's disease in poultry production makes this an especially valuable research direction.

What is the evolutionary conservation of UL34 across different strains of MDV?

The evolutionary conservation of UL34 across different strains of MDV provides important insights into its functional significance:

  • Sequence Conservation Analysis:

    • Core functional domains show high conservation (>90% amino acid identity) across MDV-1 strains

    • The transmembrane domain shows particularly high conservation, suggesting critical structural requirements

    • N-terminal regions display greater variability, potentially reflecting adaptations to different host interactions

  • Conservation Across MDV Serotypes:

    • MDV-1 (GaHV-2): Contains the virulent Md5 strain characterized in the literature

    • MDV-2 (GaHV-3): Less pathogenic serotype with UL34 homolog showing ~70-80% identity to MDV-1

    • HVT (MeHV-1): Vaccine strain with more divergent UL34 sequence but conserved function

  • Comparative Analysis with Other Avian Herpesviruses:

    • UL34 homologs in related avian herpesviruses show moderate sequence conservation

    • Functional domains remain conserved despite sequence divergence

    • This pattern suggests strong selective pressure to maintain nuclear egress functionality

  • Molecular Evolution Patterns:

    • Evidence of purifying selection in functional domains

    • Potential positive selection in regions interacting with host-specific factors

    • Evolutionary rate slower than that of surface glycoproteins but faster than highly conserved DNA replication proteins

Understanding these conservation patterns can guide the development of broadly effective antivirals and help predict the likelihood of resistance development to UL34-targeted interventions.

How should researchers interpret contradictory results regarding UL34 function in different experimental systems?

When confronted with contradictory results regarding UL34 function across different experimental systems, researchers should implement a systematic approach to interpretation:

  • Assessment of Experimental Variables:

    • Cell Type Differences: Results from CEFs may differ from those in lymphoid cells or other systems

    • Viral Strain Variations: Different MDV strains may exhibit strain-specific UL34 functions

    • Methodological Differences: Variations in protein expression levels, tagging strategies, or assay conditions

  • Analysis Framework:

    • Create a comparison matrix of experimental conditions vs. outcomes

    • Identify patterns that might explain discrepancies (e.g., cell-type dependent effects)

    • Evaluate statistical robustness of each conflicting result

  • Resolution Strategies:

    • Design experiments that directly address the source of contradiction

    • Utilize multiple complementary techniques to verify findings

    • Consider context-dependent function as a biological explanation rather than experimental error

  • Methodological Questions to Consider:

    • Was the full-length UL34 protein used, or were truncated variants employed?

    • Were tag positions influencing protein functionality?

    • Are differences in protein expression levels affecting outcomes?

    • Were appropriate controls included to rule out non-specific effects?

  • Integration of Multiple Data Types:

    • Combine structural, functional, and genetic data for comprehensive interpretation

    • Consider evolutionary conservation data when evaluating functional importance

    • Integrate findings with knowledge of related herpesvirus UL34 homologs

This structured approach to resolving contradictions can transform apparent inconsistencies into deeper insights about context-dependent protein function and highlight important biological variables affecting UL34 activity.

What bioinformatic approaches are most useful for analyzing UL34 homolog sequences?

Several bioinformatic approaches are particularly valuable for analyzing UL34 homolog sequences:

  • Sequence Alignment and Phylogenetic Analysis:

    • Multiple sequence alignment (MSA) using MUSCLE or MAFFT algorithms

    • Construction of phylogenetic trees using Maximum Likelihood or Bayesian methods

    • Identification of evolutionary relationships between UL34 homologs across different viral species

  • Protein Domain Prediction and Analysis:

    • Identification of functional domains using InterPro or SMART

    • Transmembrane region prediction using TMHMM or Phobius

    • Signal peptide analysis using SignalP

    • Disorder prediction using IUPred or PONDR

  • Structural Prediction Tools:

    • Secondary structure prediction using PSIPRED

    • Tertiary structure modeling using AlphaFold2 or I-TASSER

    • Molecular dynamics simulations for functional motion analysis

  • Evolutionary Analysis:

    • Calculation of dN/dS ratios to identify selection pressures

    • Identification of co-evolving residues using mutual information analysis

    • Ancestral sequence reconstruction to understand evolutionary trajectories

  • Network Analysis of Protein-Protein Interactions:

    • Prediction of interaction interfaces using PSIVER or SPRINT

    • Integration with experimental data from related herpesviruses

    • Visualization of interaction networks using Cytoscape

These approaches can be integrated into a comprehensive workflow that begins with basic sequence characterization and progresses to sophisticated evolutionary and structural analyses, providing multi-dimensional insights into UL34 biology.

What statistical methods are appropriate for analyzing UL34 knockout experimental data?

The analysis of UL34 knockout experimental data requires appropriate statistical methods to ensure robust interpretation:

  • Experimental Design Considerations:

    • Include multiple biological and technical replicates

    • Incorporate appropriate controls (wild-type virus, revertant strains)

    • Account for potential confounding variables in the experimental system

  • Statistical Tests for Different Data Types:

    Data TypeRecommended Statistical TestsApplication Example
    Viral Growth CurvesRepeated measures ANOVA, Area under curve analysisComparing growth kinetics of wild-type vs. UL34 mutant viruses
    Plaque Size/MorphologyStudent's t-test or Mann-Whitney U test (if non-normal)Assessing differences in plaque formation between wild-type and mutant viruses
    Protein Expression LevelsANOVA with post-hoc tests (Tukey, Bonferroni)Comparing expression of viral proteins in presence/absence of UL34
    Cell Viability/ApoptosisChi-square test, Fisher's exact testAnalyzing categorical outcomes in infected cells
    RNA-Seq/TranscriptomicsDESeq2 or edgeR, with appropriate FDR correctionIdentifying differentially expressed genes in response to UL34 knockout
  • Power Analysis and Sample Size Determination:

    • Perform a priori power analysis to determine adequate sample sizes

    • Consider effect sizes from preliminary data or related studies

    • Balance statistical power with practical experimental constraints

  • Data Visualization Approaches:

    • Use box plots or violin plots for distributional data

    • Time-series plots for growth curves with confidence intervals

    • Heat maps for multi-dimensional data (e.g., transcriptomics)

    • Forest plots for meta-analysis of multiple experiments

  • Advanced Statistical Approaches:

    • Mixed effects models for complicated experimental designs with multiple factors

    • Bayesian approaches for integration of prior knowledge with experimental data

    • Machine learning for pattern recognition in complex datasets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.