Recombinant Gamma-secretase subunit aph-1 (aph-1)

Shipped with Ice Packs
In Stock

Description

Role in Amyloid-β (Aβ) Production and Alzheimer’s Disease Pathogenesis

Aph-1 isoforms influence Aβ peptide length, a critical factor in Alzheimer’s disease (AD) progression.

Aβ Profile Modulation

ParameterAPH1A-Containing ComplexesAPH1B-Containing ComplexesSource
Aβ42/Aβ40 RatioLowerHigher
Long Aβ SpeciesReduced (e.g., Aβ42, Aβ46)Increased (e.g., Aβ42, Aβ46)
Total Aβ ProductionModerateHigher
Notch Signaling ImpactSevere in deficiencyMinimal in deficiency

APH1B complexes preferentially generate longer Aβ peptides (e.g., Aβ46), which are more amyloidogenic . This isoform-specific activity is linked to conformational differences in the PSEN1 active site and substrate channel geometry .

Key Properties of Recombinant Aph-1

PropertyValue/DescriptionSource
Molecular Weight~33,500 Da
Expression SystemE. coli, yeast, or mammalian
Purity≥85% (SDS-PAGE verified)
FunctionalityRestores GSEC activity in vitro
Tag InformationN-terminal/C-terminal tags

Mutations in Aph-1 (e.g., L30F/T164A) enhance γ-secretase activity by 1.5-fold, increasing Aβ production without altering ε-cleavage specificity .

In Vivo Relevance of APH1B in AD

  • Aph1BC−/− mice show reduced brain Aβ levels without Notch-related toxicity, supporting APH1B as a therapeutic target .

  • Human brain APH1B complexes contribute significantly to total γ-secretase activity, validating isoform-specific targeting .

Mutational Insights

MutationEffect on GSEC ActivitySource
L30F/T164A (APH1A)1.5× increased Aβ production
P88L (PSEN1)Impaired processivity, long Aβ

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
aph-1; pen-1; VF36H2L.1; Gamma-secretase subunit aph-1; Anterior-pharynx-defective protein 1; Presenilin enhancer protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
aph-1
Target Protein Sequence
MGYLLTIACYIASFSPSIALFCSFIAHDPVRIILFFLGSFFWLVSLLFSSLAWLGLSTVL PDTFLLSLTVCIIAQELSRVAYFMLLKKAQRGLNKITRQGQISVAPGVSDLHNARHMLAL VCGLGMGVISALFYTMNAFAIFSGPGTIGLPNALKTGEIDTNRAGKYLPLCYTLSAILLT LFHVTWTIMVWDSCHKIGRIPSAFVPGAAAVVSHLLVTFLSSLNSRGFHVLVFAVQFLIL LICIAYCNVIMGGTISSFVNGIGQSITDAVTLKQVRTLIEERKLRTQRQSVPDEPMTERA GTSNTVNA
Uniprot No.

Target Background

Function

Recombinant Gamma-secretase subunit aph-1 (aph-1) is an essential subunit of the gamma-secretase complex. This endoprotease complex catalyzes the intramembrane cleavage of integral proteins, such as Notch receptors (lin-12 or glp-1). Aph-1 may function as a stabilizing cofactor for the presenilin homodimer, promoting the formation of a stable complex. It is also required for the localization of aph-2.

Database Links
Protein Families
APH-1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is APH-1 and what is its role in the gamma-secretase complex?

APH-1 is a multipass membrane protein that functions as an essential subunit of the gamma-secretase complex. The complex consists of four core proteins: Presenilin (PS), APH-1, PEN-2, and Nicastrin (NCT) . APH-1 contributes directly to the proteolytic activity of the gamma-secretase complex by influencing the conformation of the catalytic PS1 subunit in situ . The gamma-secretase complex is responsible for the final cleavage of the Amyloid Precursor Protein (APP), releasing the Aβ peptide that accumulates in amyloid plaques characteristic of Alzheimer's Disease . The same complex also cleaves Notch, N-Cadherin, and other important signaling molecules .

Research methodologies to study APH-1's role typically include reconstitution experiments in model systems, co-immunoprecipitation studies to analyze protein-protein interactions, and functional assays measuring gamma-secretase activity in the presence of different APH-1 variants.

What APH-1 homologues exist and how do they differ functionally?

Multiple APH-1 homologues have been identified in mammalian systems, including APH-1A (with long and short isoforms: APH-1A L and APH-1A S), APH-1B, and APH-1C . These homologues form distinct gamma-secretase complexes with heterogeneous biochemical and physiological properties .

The functional differences between these homologues include:

APH-1 HomologueRelative Aβ Species ProductionPresenilin ConformationContribution to Brain Activity
APH-1A LHigher proportion of shorter Aβ peptides (Aβ 1-37, Aβ 1-38, Aβ 1-40)More "open" conformationPresent in human brain
APH-1BHigher proportion of longer Aβ peptides (Aβ 1-42, Aβ 1-45, Aβ 1-46, Aβ 1-49)More "closed" conformationMajor contributor to total γ-secretase activity in human brain
APH-1CSimilar to APH-1BNot specified in the dataLess studied than other homologues

These homologues can be studied using specific antibodies for immunoprecipitation followed by activity assays to isolate and characterize the distinct gamma-secretase complexes containing different APH-1 variants .

How does APH-1 contribute to Alzheimer's disease pathology?

APH-1-containing gamma-secretase complexes contribute to Alzheimer's disease pathology through their role in APP processing and subsequent Aβ peptide generation. APH-1B-containing complexes in particular produce a greater proportion of longer Aβ peptide species (Aβ 1-42, Aβ 1-45, Aβ 1-46, Aβ 1-49) relative to shorter Aβ peptides . While the Aβ 1-42/1-40 ratio remained consistent between different APH-1 genotypes in studies, a significant reduction in total Aβ peptide production was observed in brain extracts from APH-1BC knockout mice .

The research approach to studying this contribution involves targeted genetic manipulation (such as creating knockout models), brain extract analysis for Aβ peptide quantification, and in vitro cleavage assays to assess the specific activity of different APH-1-containing complexes.

How do specific mutations in APH-1 affect gamma-secretase activity and substrate specificity?

Specific mutations in APH-1 can significantly alter gamma-secretase activity. Random mutagenesis studies have identified that the APH-1aL L30F/T164A double mutation increases both the ε-cleavage activity of gamma-secretase and Aβ production . This finding has been validated using multiple experimental systems including a yeast reporter system, in vitro assays using microsomes, and mammalian cell (MEF) studies .

Structural analysis through cryo-EM has revealed that Leu30 of APH-1 is located on the amino-terminal side of TMD1 of PS1, while Thr164 is close to the carboxy-terminus of PS1 . The L30F mutation likely affects the conformation of TMD1 in PS1, altering enzyme activity. Additionally, the distance between the oxygen atom of Thr164 of APH-1 and the oxygen atom of Tyr466 of PS1 is predicted to be 3.5 Å, suggesting a hydrogen bond that may be critical for function .

Research methodologies to study mutation effects include:

  • Error-prone PCR for random mutagenesis

  • Yeast reconstitution systems for initial screening

  • In vitro gamma-secretase activity assays

  • Structural studies using cryo-EM

  • Site-directed mutagenesis to confirm the role of specific residues

What are the structural determinants of APH-1 that influence gamma-secretase conformation and activity?

Key structural elements of APH-1 that influence gamma-secretase conformation and activity include:

  • Transmembrane domains with specific conserved amino acids: Gln83, Glu84, Arg87 (TMD3), Gly122, Gly126 (GxxxG motif, TMD4), His171 (TMD5), and His197 (TMD6) are important for complex formation and activity .

  • Specific regions that interact with PS1: APH-1's position relative to PS1 influences the conformation of the catalytic subunit, with APH-1B consistently demonstrating a more "closed" conformation of PS1 compared to APH-1A-containing complexes . This conformational difference was detected using Fluorescent Lifetime Imaging Microscopy (FLIM), which measures the proximity between fluorophores attached to different domains of a molecule .

  • Substrate-binding interfaces: The carboxy terminus of PS1 forms substrate-binding sites in cooperation with its hydrophilic loop 1 (HL1), and APH-1's Thr164 potentially forms a hydrogen bond with PS1's Tyr466, which may influence this binding interface .

Methodological approaches to study these structural determinants include:

  • FLIM analysis for conformational studies

  • Mutagenesis of specific residues followed by functional assays

  • Cryo-EM structural studies

  • Molecular dynamics simulations

  • Cross-linking studies to map protein-protein interactions

How can APH-1-specific targeting be achieved for potential therapeutic applications in Alzheimer's disease?

Selective targeting of APH-1B-containing gamma-secretase complexes represents a promising therapeutic approach for Alzheimer's disease with potentially fewer side effects than broad gamma-secretase inhibition . This is supported by studies showing that specific inactivation of the APH-1B gamma-secretase in a murine Alzheimer's disease model led to improvements of AD-relevant phenotypic features without any Notch-related side effects .

In contrast, a 50% reduction in gamma-secretase activity in Nicastrin heterozygous mice is associated with severe Notch side effects . The complete removal of the APH-1B complex component achieved efficient reduction of amyloid pathology in mouse brain without Notch-related problems .

Methods to develop APH-1B-specific targeting strategies include:

  • Structure-based drug design targeting the unique interfaces in APH-1B complexes

  • High-throughput screening for compounds that selectively inhibit APH-1B-containing complexes

  • Development of antibodies or peptides that specifically bind to APH-1B but not other homologues

  • Antisense oligonucleotides or siRNA approaches to selectively reduce APH-1B expression

  • Identification of post-translational modifications specific to APH-1B that could be targeted

What are the optimal methods for expressing and purifying recombinant APH-1 for in vitro studies?

Recombinant APH-1 expression and purification present challenges due to its multipass membrane protein nature. Based on successful approaches in the literature, the following methodology is recommended:

  • Expression Systems:

    • Yeast expression systems (such as Pichia pastoris) for functional studies, as demonstrated by the successful use of yeast reconstitution systems for gamma-secretase activity analysis

    • Mammalian expression systems (HEK293, CHO cells) for studies requiring mammalian post-translational modifications

    • Baculovirus-infected insect cells for higher yield of properly folded membrane proteins

  • Construct Design:

    • Include affinity tags (His6, FLAG, or strep-tag) preferably at the C-terminus to minimize interference with function

    • Consider fusion partners such as maltose-binding protein to enhance solubility

    • Include TEV or PreScission protease cleavage sites for tag removal

  • Membrane Protein Extraction:

    • Use mild detergents (DDM, CHAPS, or digitonin) for extraction while maintaining protein-protein interactions

    • Consider lipid nanodiscs or amphipols for stabilizing the purified protein in a near-native lipid environment

  • Purification Strategy:

    • Affinity chromatography as the initial capture step

    • Size-exclusion chromatography to separate monomeric from aggregated protein

    • Ion exchange chromatography for further purification if needed

  • Quality Control:

    • Western blotting to confirm identity

    • Blue Native PAGE to assess complex formation capabilities

    • Limited proteolysis to verify proper folding

    • Activity assays using recombinant substrates (APPC99 and NotchΔE) to confirm functionality

How can researchers effectively study the interaction between APH-1 and other gamma-secretase components?

Multiple complementary approaches can be employed to study the interactions between APH-1 and other gamma-secretase components:

  • Co-immunoprecipitation (Co-IP):

    • Use specific antibodies against APH-1 homologues to pull down associated proteins

    • This method has been successfully employed to isolate specific gamma-secretase pools from both mouse and human brain tissues

    • Compare the "depleted" (unbound) and "enriched" (bound) fractions for both composition and activity

  • Fluorescent Lifetime Imaging Microscopy (FLIM):

    • Attach fluorophores to different domains of gamma-secretase components

    • Measure the proximity between fluorophores to detect conformational changes

    • This approach has revealed that APH-1B-containing complexes demonstrate a shorter lifetime than APH-1A-containing complexes, indicating a more "closed" conformation of PS1

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):

    • Evaluate complex formation in its native state

    • Has been successfully used to confirm restoration of complex formation in APH-1ABC knockout MEFs reconstituted with single APH-1 homologues

  • Cross-linking Studies:

    • Use chemical cross-linkers of varying lengths to identify proteins in close proximity

    • Coupled with mass spectrometry to identify interaction interfaces

    • Particularly useful for mapping the spatial organization of the complex

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent proteins are fused to potential interaction partners

    • When the proteins interact, the fluorescent protein fragments come together to produce a signal

    • Allows visualization of protein interactions in living cells

  • Cryo-EM Structural Analysis:

    • Provides high-resolution structural information about the complex

    • Has revealed the positioning of APH-1 relative to other complex components, such as the relationship between Leu30 of APH-1 and TMD1 of PS1

How should researchers analyze and interpret differences in Aβ peptide profiles between different APH-1 homologues?

The analysis of Aβ peptide profiles generated by different APH-1-containing gamma-secretase complexes requires careful methodological consideration:

  • Analytical Techniques:

    • Mass spectrometry (MS) for precise identification and quantification of Aβ peptide species

    • ELISA assays for specific Aβ variants (particularly Aβ1-40 and Aβ1-42)

    • Western blotting with specific antibodies for different Aβ lengths

    • Immunoprecipitation combined with in vitro cleavage assays for isolated complexes

  • Data Normalization Approaches:

    • Normalize to total Aβ production to compare relative proportions of different peptide species

    • Consider calculating ratios (e.g., Aβ1-42/Aβ1-40) to assess pathologically relevant parameters

    • Use internal standards for MS-based quantification

  • Interpretation Framework:

    • Compare the proportions of longer Aβ peptides (Aβ 1-42, Aβ 1-45, Aβ 1-46, Aβ 1-49) versus shorter species (Aβ 1-37, Aβ 1-38, Aβ 1-40)

    • Consider that APH-1B and APH-1C complexes produce a greater proportion of longer Aβ species compared to APH-1A complexes

    • Assess both in vitro (using recombinant substrates) and in vivo (tissue extracts) peptide profiles

    • Recognize that while the Aβ1-42/1-40 ratio may remain constant between genotypes, the total Aβ production can vary significantly

  • Statistical Analysis:

    • Apply appropriate statistical tests for comparing multiple peptide species

    • Consider multivariate analysis to identify patterns in peptide profiles

    • Account for both biological and technical replicates

What are the most important considerations when designing experiments to investigate APH-1 function in different model systems?

When designing experiments to investigate APH-1 function across different model systems, researchers should consider:

  • Model System Selection:

    • Cellular models: MEFs derived from APH-1ABC knockout mice allow reconstitution with specific homologues

    • Yeast models: Useful for initial screening of mutations and reconstitution studies

    • Drosophila: Provides insights into developmental phenotypes related to Notch signaling

    • C. elegans: Valuable for studying APH-1's role in Notch-mediated developmental processes

    • Transgenic mice: Essential for in vivo validation and assessment of physiological relevance

  • Genetic Manipulation Strategies:

    • Complete knockout vs. selective targeting of specific homologues

    • Conditional/inducible systems to avoid developmental lethality

    • Knockin of specific mutations (e.g., L30F/T164A) to assess functional consequences in vivo

    • Consider maternal contribution effects, as maternally provided APH-1 function may be sufficient for certain developmental processes

  • Readout Selection:

    • Biochemical: gamma-secretase activity using recombinant substrates APPC99 and NotchΔE

    • Cellular: Notch signaling pathway activation, APP processing

    • Developmental: Phenotypes related to Notch pathway dysfunction (e.g., sterility in C. elegans)

    • Pathological: Amyloid plaque formation, cognitive deficits in AD models

  • Control Considerations:

    • Include multiple APH-1 homologues for comparison

    • Compare against total gamma-secretase activity (e.g., using PS1-specific antibodies for immunoprecipitation)

    • Include both gain-of-function and loss-of-function approaches

    • Consider compensatory mechanisms in chronic knockout/knockdown models

  • Translational Relevance:

    • Validate findings in human-derived samples or models when possible

    • Consider species-specific differences in APH-1 expression and function

    • Address therapeutic potential by assessing both target efficacy and off-target effects (particularly Notch-related)

How can researchers address the apparent contradictions in APH-1 research literature regarding its effects on gamma-secretase activity?

When addressing contradictions in the research literature regarding APH-1's effects on gamma-secretase activity, researchers should:

What are the most promising approaches for developing selective modulators of APH-1 homologue-specific gamma-secretase activity?

The development of selective modulators targeting specific APH-1 homologues represents a frontier in gamma-secretase research with therapeutic potential. The most promising approaches include:

These approaches hold promise for developing therapeutics with improved safety profiles compared to pan-gamma-secretase inhibitors, as selective targeting of APH-1B has been shown to reduce amyloid pathology without Notch-related side effects in mouse models .

How might single-cell analysis techniques advance our understanding of APH-1 homologue expression and function in different cell types?

Single-cell analysis techniques offer unprecedented insights into cell-type-specific expression and function of APH-1 homologues, potentially revealing:

  • Cell-Type Specific Expression Patterns:

    • Single-cell RNA sequencing (scRNA-seq) to map APH-1 homologue expression across brain cell types

    • Spatial transcriptomics to understand regional distribution of APH-1 variants in intact tissue

    • Single-cell proteomics to correlate mRNA with protein levels for different homologues

  • Functional Heterogeneity:

    • Single-cell CRISPR screens to identify cell-type-specific dependencies on different APH-1 homologues

    • Live-cell imaging of gamma-secretase activity in individual cells using FRET-based sensors

    • Correlation of APH-1 expression with substrate processing at single-cell resolution

  • Disease-Related Changes:

    • Compare APH-1 homologue expression in healthy vs. AD patient-derived cells

    • Track changes in APH-1 expression during disease progression using longitudinal single-cell analyses

    • Identify rare cell populations with unique APH-1 expression patterns that may be particularly vulnerable in disease

  • Methodological Approaches:

    • Development of homologue-specific antibodies compatible with single-cell immunofluorescence

    • Optimization of proximity ligation assays to detect specific APH-1-containing complexes in situ

    • Integration of multi-omics data (transcriptomics, proteomics, metabolomics) at single-cell level

Single-cell approaches may reveal previously unrecognized heterogeneity in APH-1 function that could explain why selective targeting of APH-1B-containing complexes reduces amyloid pathology without compromising essential Notch signaling .

How does our current knowledge of APH-1 integrate into the broader understanding of gamma-secretase biology and Alzheimer's disease pathogenesis?

The evolving understanding of APH-1 contributes significantly to our broader comprehension of gamma-secretase biology and Alzheimer's disease pathogenesis in several key ways:

  • Structural and Functional Heterogeneity:

    • The discovery that different APH-1 homologues create functionally distinct gamma-secretase complexes has transformed our understanding of gamma-secretase from a single entity to a family of related enzymes with potentially different physiological roles

    • This heterogeneity explains why broad gamma-secretase inhibition causes severe side effects while selective targeting may achieve therapeutic benefits with greater safety

  • Mechanistic Insights:

    • APH-1's influence on PS1 conformation provides a molecular mechanism for how accessory subunits regulate the catalytic activity of the complex

    • The identification of specific mutations that enhance activity (L30F/T164A) offers new structural insights into gamma-secretase regulation

  • Therapeutic Implications:

    • The finding that APH-1B-containing complexes contribute significantly to total gamma-secretase activity in the human brain while producing proportionally more pathogenic longer Aβ species provides a rational basis for selective therapeutic targeting

    • The demonstration that targeting APH-1B improves AD-relevant phenotypes without Notch-related side effects represents a potential breakthrough for therapeutic development

  • Developmental Biology Connections:

    • APH-1's essential role in Notch signaling and developmental processes highlights the evolutionary importance of this protein beyond its pathological role in AD

    • The maternal contribution of APH-1 function sufficient for certain developmental processes reveals complex regulatory mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.