Recombinant Gamma-secretase subunit pen-2 (pen-2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Gamma-Secretase Subunit Pen-2 (Pen-2)

Recombinant Pen-2 is a synthetic version of the native Pen-2 protein, a critical component of the γ-secretase complex. This multi-subunit complex, which includes Presenilin (PS), Nicastrin (Nct), and Aph-1, is responsible for intramembranous cleavage of amyloid precursor protein (APP) and Notch receptors, generating amyloid β-peptide (Aβ) linked to Alzheimer’s disease (AD) . Recombinant Pen-2 is engineered for research purposes, enabling functional, structural, and therapeutic studies of γ-secretase activity .

Production and Purification of Recombinant Pen-2

Recombinant Pen-2 is typically produced via bacterial expression systems (e.g., E. coli) or cell-free synthesis . Key steps include:

  1. Cloning: Insertion of the Pen-2 gene into expression vectors.

  2. Expression: Induction of protein synthesis in E. coli or in vitro systems.

  3. Purification: Chromatography-based methods (e.g., Ni-NTA affinity) to achieve >85% purity .

Key Functional Insights:

  • Mutagenesis Studies:

    • TMD1 Mutations (e.g., N33A): Increase γ-secretase surface localization but reduce stability .

    • C-Terminal Deletions: Disrupt PS1-CTF binding and destabilize the complex .

  • Activity Modulation: Pen-2’s DYSLF motif alters Aβ42/Aβ40 ratios, mimicking familial AD mutations .

Disease Modeling and Drug Discovery

  • Alzheimer’s Disease: Recombinant Pen-2 is used to study γ-secretase inhibitors/modulators (e.g., semagacestat) and their effects on Aβ production .

  • Notch Signaling: Pen-2’s role in Notch cleavage is explored in developmental studies .

Functional Assays

  • Enzymatic Activity: Co-expression with PS1 in vitro reconstitutes γ-secretase activity, enabling Aβ ELISA measurements .

  • Proteasomal Degradation: Pen-2 mutants (e.g., I53A) show reduced stability, highlighting its role in complex turnover .

Critical Residues and Functional Roles

Table 3: Functional Impact of Pen-2 Mutations

MutationLocationEffect on γ-SecretaseSource
N33ATMD1Increased surface localization, reduced stability
I53ACytosolic Loop10-fold stability loss, 50% activity reduction
DYSLF → AYSLFC-TerminalDisrupted PS1-CTF binding, complex degradation

Pen-2-Independent PS1 Endoproteolysis

Minor PS1 cleavage occurs in Pen-2-deficient systems, but full activity requires Pen-2-mediated stabilization .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
pen-2; T28D6.9; Gamma-secretase subunit pen-2; Presenilin enhancer protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
pen-2
Target Protein Sequence
MDISKLTDVKKVDLCKKYFLIGACFLPLVWIVNTFWFFSDAFCKPINAHRRQIRKYVIAS IVGSIFWIIVLSAWEIFFQHYRAQGLVWTDFLTFVFPTGRV
Uniprot No.

Target Background

Function

Function: Pen-2 is an essential subunit of the γ-secretase complex, an intramembrane-cleaving protease responsible for processing integral membrane proteins such as Notch (glp-1 or lin-12). It functions as a stabilizing cofactor for the presenilin homodimer, facilitating the formation of a stable γ-secretase complex.

Database Links

KEGG: cel:CELE_T28D6.9

STRING: 6239.T28D6.9

UniGene: Cel.9963

Protein Families
PEN-2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Note=Predominantly located in the endoplasmic reticulum and Golgi region.
Tissue Specificity
Expressed from 100-cell stage in most somatic tissues, including neurons, muscle, intestine and developing vulva. Little or not expressed in early embryos.

Q&A

What is the molecular structure of Pen-2?

Pen-2 is a highly conserved 101 amino acid protein with two hydrophobic transmembrane domains (TMDs). It adopts a hairpin topology with the loop domain exposed to the intracellular side of the cell membrane . This structure is remarkably conserved across vertebrates, displaying 70% identity and 87% similarity . The protein contains several functionally critical regions:

  • The N-terminal region of TMD1 interacts with TMD4 of presenilin-1 (PS1)

  • The C-terminal domain contains a conserved DYSLF motif essential for complex stability

  • Glycine 22 and proline 27 in hydrophobic domain 1 are crucial for complex formation

What is the role of Pen-2 in γ-secretase activity?

Pen-2 serves multiple critical functions beyond being merely a structural component:

The essential nature of Pen-2 is demonstrated by knockout studies showing that Pen-2-deficient mice exhibit embryonic lethality by day 11, resembling the phenotype of PS1/PS2 double knockout mice .

How does Pen-2 integrate into the γ-secretase complex assembly process?

The γ-secretase complex assembles in a sequential manner:

  • Nicastrin (NCT) and APH-1 initially form a heterodimeric intermediate complex

  • This heterodimer binds to the C-terminal region of presenilin, creating a trimeric complex

  • Pen-2 is recruited as the final component, triggering presenilin endoproteolysis

During this process, the N-terminal part of hydrophobic domain 1 of Pen-2 interacts specifically with TMD4 of PS1, including the conserved Trp-Asn-Phe sequence . This interaction is crucial for the endoproteolytic processing of presenilin and subsequent activation of the complex.

What are effective strategies for recombinant expression and purification of Pen-2?

For successful recombinant expression and purification of functional Pen-2:

Table 1: Validated Pen-2 Expression and Purification Strategies

StrategyImplementationFunctional OutcomeReference
MBP fusionMBP-tagged Pen-2 expressed in expression systemsMaintains functionality when incorporated into γ-secretase
2A peptide technologyStoichiometric co-expression with other γ-secretase componentsForms functional complexes with specific activities
C-terminal taggingAddition of small tags (myc, His)Can affect complex stability if not carefully designed

The MBP-fusion approach has been demonstrated to yield Pen-2 in quantities sufficient for structural analysis while maintaining functional integrity . When incorporated into γ-secretase complexes, MBP-tagged Pen-2 supports substrate cleavage, confirming preservation of its essential functions .

How can researchers assess the functional integrity of recombinant Pen-2?

Functional assessment of recombinant Pen-2 should evaluate multiple aspects:

  • Ability to trigger PS1 endoproteolysis: Monitor the conversion of full-length PS1 to N- and C-terminal fragments by SDS-PAGE and western blotting

  • Complex formation capacity: Assess the ability to incorporate into the γ-secretase complex through co-immunoprecipitation or gel filtration chromatography

  • Stabilization of PS fragments: Evaluate the stability of PS1 fragments in the presence of wild-type versus mutant Pen-2, with and without proteasome inhibitors

  • Impact on γ-secretase activity: Measure substrate cleavage in reconstituted systems containing recombinant Pen-2

When mutations or modifications are introduced, researchers should thoroughly evaluate these parameters to ensure that the recombinant protein retains physiologically relevant functions.

What techniques are most effective for studying Pen-2 interactions within the γ-secretase complex?

Several complementary approaches have proven valuable:

  • Scanning cysteine accessibility method (SCAM): This technique has been used to demonstrate that glycine 22 and proline 27 in hydrophobic domain 1 of Pen-2 are essential for complex formation and stability

  • Chimeric protein approaches: Creating domain-swapped constructs between Pen-2 and other membrane proteins has identified that the proximal two-thirds of TMD4 of PS1 are required for interaction with Pen-2

  • In vitro reconstitution: Purified components can be combined to study minimal requirements for interactions, revealing that PS1 and Pen-2 alone are sufficient for some degree of PS1 endoproteolysis

  • Systematic mutagenesis: Targeted mutations in specific Pen-2 domains followed by functional assays have identified critical regions for activity and stability

  • Cross-linking studies: These reveal proximity relationships between Pen-2 and other subunits, showing that hydrophobic domain 1 and the loop domain are located in a water-containing cavity near the PS1 C-terminal fragment

Which specific regions and residues in Pen-2 are critical for γ-secretase function?

Systematic mutagenesis studies have identified region-specific effects on γ-secretase function:

Table 2: Effects of Mutations in Different Pen-2 Regions

RegionMutation EffectFunctional Impact
First half of TMD1Decreased activityReduced PS1 endoproteolysis and γ-secretase activity
Second half of TMD1Increased activityEnhanced proteolytic function
N33A in TMD1Altered traffickingIncreased γ-secretase at cell surface, modest stability decrease
Cytosolic loopDecreased activityI53A reduces stability 10-fold and activity by half
TMD2Decreased processingReduced PS1 endoproteolysis
First half of TMD2Decreased activityReduced proteolytic function
C-terminal residuesDecreased activityImpaired proteolytic function
DYSLF motif (C-terminus)Complex stabilitySimultaneous mutation disrupts function

These findings illustrate the multifaceted role of Pen-2 in complex assembly, stability, and activity . The differential effects of mutations in various regions suggest that Pen-2 contributes to multiple aspects of γ-secretase function beyond merely facilitating PS1 endoproteolysis.

How does Pen-2 contribute to γ-secretase complex stability?

Pen-2 plays a dual role in both formation and maintenance of the γ-secretase complex:

  • Endoproteolysis facilitation: While primarily known for triggering PS1 endoproteolysis, research confirms that minor PS1 endoproteolysis can occur in the complete absence of Pen-2

  • Post-endoproteolytic stabilization: More critically, Pen-2 stabilizes the N- and C-terminal fragments of PS1 after endoproteolysis, preventing their rapid proteasomal degradation

  • Complex assembly timing: Rather than solely catalyzing endoproteolysis, Pen-2 may stabilize the complex prior to PS1 endoproteolysis, allowing sufficient time for full assembly and proper trafficking

  • C-terminal domain function: The C-terminal domain, particularly the conserved DYSLF motif, is essential for stabilizing PS fragments, as progressive truncation of this region causes increasing functional loss

These findings reveal Pen-2 as a multifunctional component that contributes to both the formation and maintenance of stable, active γ-secretase complexes.

How does the presenilin variant affect Pen-2-containing complexes?

The presenilin variant (PS1 vs. PS2) in the γ-secretase complex has profound effects on subcellular localization:

  • PS1-containing complexes: Predominantly targeted to the plasma membrane

  • PS2-containing complexes: Primarily directed to the trans-Golgi network and endosomal compartments

This differential targeting is functionally significant as it determines which substrates are accessible to the enzyme complex. The composition-dependent targeting suggests that different γ-secretase complexes may serve distinct physiological functions based on their subcellular localization.

Further, the PS variant affects Pen-2 interactions:

  • PS1 TMD4 contains a direct binding motif for Pen-2, with the proximal two-thirds being critical for this interaction

  • Some PS1 mutations (G209V, L235R, E280G) show incomplete endoproteolysis despite Pen-2 presence

  • Eight PS1 variants nearly abolish endoproteolysis entirely, as evidenced by intact PS1 and missing NTF/CTF bands

How can Pen-2 be utilized in structural studies of the γ-secretase complex?

Structural studies of γ-secretase present significant challenges due to its 19-transmembrane domain architecture. Recombinant Pen-2 offers several approaches:

  • Individual subunit analysis: As demonstrated by MBP-fusion approaches, Pen-2 can be purified in quantities sufficient for standalone structural analysis by techniques such as X-ray crystallography, NMR, or 2D crystallography

  • Complex reconstitution: Using purified recombinant components including Pen-2 for in vitro assembly of partial or complete γ-secretase complexes

  • Modular complex building: Employing 2A peptide technology for stoichiometric co-expression of different γ-secretase subunit combinations including EGFP-tagged nicastrin with Pen-2

  • Chimeric constructs: Creating domain-swapped proteins where specific Pen-2 regions are exchanged with corresponding regions of unrelated proteins to identify structural determinants of function

These approaches can yield complementary structural information that, together, may help elucidate the architecture and working mechanism of the complete γ-secretase complex.

What is the relationship between Pen-2 and presenilin mutations in Alzheimer's disease?

Presenilin mutations account for the majority of familial Alzheimer's disease cases, and their relationship with Pen-2 reveals important disease mechanisms:

  • Endoproteolysis effects: Analysis of 138 AD-derived PS1 mutations showed varying effects on endoproteolysis, with some mutations (G209V, L235R, E280G) showing incomplete processing despite Pen-2 presence

  • Critical interaction sites: The PS1 TMD4, which contains the Pen-2 binding site, is in close proximity to many disease-causing mutations, suggesting potential effects on Pen-2 interaction

  • Stability relationships: The stabilizing function of Pen-2's C-terminal domain becomes particularly important for certain PS1 mutants that might otherwise undergo rapid degradation

  • Processing outcomes: Different PS1 mutations produce distinct effects on γ-secretase activity and Aβ peptide profiles, which may be influenced by their interaction with Pen-2

Understanding these relationships is crucial for developing targeted therapeutic approaches that might normalize γ-secretase function in the context of specific PS1 mutations.

How can recombinant Pen-2 be used to study γ-secretase modulators?

Recombinant Pen-2 provides valuable tools for studying γ-secretase modulators (GSMs) that alter Aβ production patterns:

  • Direct binding studies: Since some GSMs that decrease Aβ42 production bind primarily to Pen-2, recombinant proteins enable direct binding assays and structure-activity relationship studies

  • Mutagenesis screens: Systematic mutation of Pen-2 residues can identify specific amino acids involved in GSM binding and efficacy

  • Activity assays: Reconstituted systems containing recombinant Pen-2 allow assessment of how GSMs affect γ-secretase activity and processivity

  • Conformational analysis: Evaluating how GSM binding to Pen-2 alters its interaction with other γ-secretase components, potentially explaining mechanisms of modulation

Such studies are particularly valuable because they enable a more targeted approach to Alzheimer's disease drug development, focusing on modulating rather than inhibiting γ-secretase activity.

What are common challenges in working with recombinant Pen-2 and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant Pen-2:

  • Poor expression/solubility: As a small, hydrophobic membrane protein, Pen-2 can be difficult to express and solubilize

    • Solution: Use fusion tags like MBP that enhance solubility and expression levels

    • Solution: Express with other γ-secretase components using 2A peptide technology for proper folding

  • Loss of functionality: Modifications for purification may compromise function

    • Solution: Validate that recombinant proteins support PS1 endoproteolysis and γ-secretase activity

    • Solution: Position tags carefully, avoiding the C-terminal DYSLF motif region critical for function

  • Complex dissociation during purification: γ-secretase complexes containing Pen-2 may dissociate during purification

    • Solution: Use mild detergents and optimize buffer conditions to maintain complex integrity

    • Solution: Consider crosslinking approaches to stabilize interactions prior to purification

  • Variable endoproteolysis: Incomplete PS1 endoproteolysis may occur

    • Solution: Verify Pen-2 integration into the complex via immunoblotting for all components

    • Solution: Extend incubation times to allow for complete endoproteolysis

How can researchers distinguish between direct and indirect effects of Pen-2 mutations?

When analyzing Pen-2 mutations, distinguishing direct functional effects from indirect consequences requires a systematic approach:

  • Stability vs. activity analysis: Separate effects on complex stability from direct activity modulation by:

    • Comparing mutation effects with and without proteasome inhibitors

    • Assessing complex formation via co-immunoprecipitation

    • Measuring activity in stabilized complexes

  • Domain-specific effects: Analyze region-specific impacts through:

    • Systematic scanning mutagenesis across all Pen-2 domains

    • Creation of chimeric constructs with gradual domain replacements

    • Structure-guided point mutations of conserved residues

  • Temporal sequence analysis: Determine whether effects are on assembly, endoproteolysis, or post-processing stability:

    • Pulse-chase experiments to track complex formation kinetics

    • Time-course analysis of PS1 endoproteolysis

    • Stability measurements of pre-formed complexes after introducing mutations

Such comprehensive approaches can disentangle the complex roles of different Pen-2 regions in the multiple steps of γ-secretase assembly and function.

What controls are essential when evaluating recombinant Pen-2 in functional assays?

Rigorous experimental design requires several controls when studying recombinant Pen-2:

  • Endoproteolysis controls:

    • Positive control: Wild-type Pen-2 to demonstrate normal PS1 processing

    • Negative control: Pen-2 knockdown/knockout condition to establish baseline endoproteolysis

    • Processing verification: Immunoblotting for both full-length PS1 and N/C-terminal fragments

  • Activity controls:

    • Substrate specificity: Multiple γ-secretase substrates to distinguish general vs. substrate-specific effects

    • Known modulators: GSMs and inhibitors with established mechanisms for comparison

    • Kinetic analysis: Time-course measurements to differentiate rate effects from absolute activity changes

  • Stability controls:

    • Proteasome inhibition: Testing with and without proteasome inhibitors to distinguish degradation from assembly defects

    • Temperature sensitivity: Assess complex stability under varying temperature conditions

    • Detergent resistance: Evaluate complex integrity in different detergent concentrations

These controls ensure that observed effects can be correctly attributed to specific functions of Pen-2 rather than experimental artifacts or indirect consequences of manipulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.