Recombinant GDP-mannose-dependent alpha- (1-2)-phosphatidylinositol mannosyltransferase

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant GDP-Mannose-Dependent Alpha-(1-2)-Phosphatidylinositol Mannosyltransferase

Recombinant GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase is a recombinant enzyme involved in the biosynthesis of phosphatidylinositol mannosides (PIMs). This enzyme catalyzes the transfer of a mannose residue from GDP-mannose to the 2-position of phosphatidylinositol (PI), forming phosphatidylinositol monomannoside (PIM1). The recombinant form of this enzyme is produced through genetic engineering techniques, often in host organisms like Escherichia coli or Pichia pastoris, to facilitate research and industrial applications.

Biochemical Function

The primary biochemical function of GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase is to initiate the synthesis of PIMs by transferring a mannose residue from GDP-mannose to the inositol ring of PI. This step is crucial in the biosynthesis pathway of PIMs, which are essential components of the cell wall in mycobacteria and other organisms. The enzyme's activity is specific to the alpha-(1-2) linkage, distinguishing it from other mannosyltransferases that form different linkages.

Production and Characteristics

Recombinant GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase proteins are available for research purposes. For example, Creative BioMart offers a recombinant full-length version of this enzyme, expressed in E. coli and tagged with a His-tag for easy purification . The characteristics of this recombinant protein include:

Product DetailsDescription
Source (Host)E. coli
SpeciesHuman
TagHis
Protein LengthFull Length (1-378)

Pathways and Interactions

This enzyme participates in several biochemical pathways, primarily in the synthesis of PIMs. The pathways involve a series of mannosylation and acylation steps to form higher-order PIMs. Interacting proteins and molecules include other enzymes involved in the PIM biosynthesis pathway, such as PimB and acyltransferases .

Research Findings

Research on GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase has shed light on its role in mycobacterial cell wall biosynthesis. Studies have shown that this enzyme is essential for the growth of mycobacteria, as it initiates the formation of PIMs, which are critical components of the mycobacterial cell envelope . The enzyme's specificity for the alpha-(1-2) linkage is a key feature that distinguishes it from other mannosyltransferases involved in different stages of PIM synthesis .

Applications and Future Directions

The recombinant form of this enzyme has potential applications in biotechnology and pharmaceutical research. It can be used to study the biosynthesis of PIMs and to develop new therapeutic targets against mycobacterial infections. Additionally, understanding the biochemical pathways involving this enzyme can provide insights into the development of novel antimicrobial agents.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as per the customer's requirements.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pimA; ML0452; MLCL581.14c; Phosphatidyl-myo-inositol mannosyltransferase; Alpha-mannosyltransferase; GDP-mannose-dependent alpha-(1-2-phosphatidylinositol mannosyltransferase; Guanosine diphosphomannose-phosphatidyl-inositol alpha-mannosyltransferase; Phosphatidylinositol alpha-mannosyltransferase; PI alpha-mannosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-374
Protein Length
full length protein
Species
Mycobacterium leprae (strain TN)
Target Names
pimA
Target Protein Sequence
MRIGMICPYSFDVPGGVQSHVLQLAEVMRARGQQVRVLAPASPDVSLPEYVVSAGRAIPI PYNGSVARLQFSPAVHSRVRRWLVDGDFDVLHLHEPNAPSLSMWALRVAEGPIVATFHTS TTKSLTLSVFQGVLRPWHEKIIGRIAVSDLARRWQMEALGSDAVEIPNGVNVDSLSSAPQ LAGYPRLGKTVLFLGRYDEPRKGMSVLLDALPGVMECFDDVQLLIVGRGDEEQLRSQAGG LVEHIRFLGQVDDAGKAAAMRSADVYCAPNIGGESFGIVLVEAMAAGTPVVASDLDAFRR VLRDGEVGHLVPAGDSAALADALVALLRNDVLRERYVAAGAEAVRRYDWSVVASQIMRVY ETVATSGSKVQVAS
Uniprot No.

Target Background

Function

This protein is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIMs), which are key precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM). Specifically, it catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the 2-position of phosphatidyl-myo-inositol (PI), generating phosphatidyl-myo-inositol with an α-1,2-linked mannose residue (PIM1).

Database Links

KEGG: mle:ML0452

STRING: 272631.ML0452

Protein Families
Glycosyltransferase group 1 family, Glycosyltransferase 4 subfamily
Subcellular Location
Cell membrane; Peripheral membrane protein; Cytoplasmic side.

Q&A

What is GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase (PimA) and what is its primary function?

PimA (Rv2610c in Mycobacterium tuberculosis) is an essential enzyme that catalyzes the transfer of a mannose moiety (M) from GDP-mannose (GDPM) to the 2-position of phosphatidyl-myo-inositol (PI), producing GDP and phosphatidyl-myo-inositol monomannoside (PIM1) . This reaction represents the first step in the biosynthesis pathway of phosphatidylinositol mannosides (PIMs), lipomannan (LM), and lipoarabinomannan (LAM), which are critical components of the mycobacterial cell envelope involved in virulence, survival, and antibiotic resistance .

The direct evidence for PimA's function was established through cell-free assays where membranes from M. smegmatis overexpressing the PimA gene incorporated mannose from GDP-[14C]Man into di- and tri-acylated phosphatidylinositol mono-mannosides. Additionally, crude extracts from Escherichia coli producing recombinant PimA were shown to synthesize diacylated phosphatidylinositol mono-mannoside from GDP-[14C]mannose .

What is the structural organization of PimA and how does it relate to its function?

PimA exhibits a two-domain organization that is typical of GT-B glycosyltransferases, as revealed by crystallographic studies . The enzyme structure consists of N-terminal and C-terminal domains connected by a linker region. The N-terminal domain is involved in membrane attachment, while the C-terminal domain contributes to the catalytic activity .

Molecular dynamics (MD) simulations demonstrate that PimA can adopt both "open" and "closed" conformations during its catalytic cycle. The enzyme is most dynamic in its free form but becomes more stable when bound to both GDP-mannose and phosphatidylinositol, adopting a closed conformation that facilitates the mannose transfer reaction .

The crystal structure of PimA in complex with GDP-mannose shows the catalytic machinery responsible for the mannosyltransferase activity. This structural information provides valuable insights into substrate recognition and the mechanism of interfacial catalysis .

What are the essential substrates and products in the PimA-catalyzed reaction?

The PimA-catalyzed reaction involves the following key components:

Substrates:

  • GDP-mannose (GDPM): The donor substrate providing the mannose moiety

  • Phosphatidyl-myo-inositol (PI): The acceptor substrate receiving the mannose at the 2-OH position of the myo-inositol ring

Products:

  • Phosphatidyl-myo-inositol monomannoside (PIM1): The mannosylated product

  • GDP: The nucleotide released after mannose transfer

The reaction occurs at the membrane interface, with PimA recognizing the lipid substrate PI embedded in the membrane . PIM1 serves as both an end product and an intermediate in the biosynthesis of higher-order PIMs, LM, and LAM .

What experimental methods are most effective for studying PimA structure and function?

Several complementary approaches have proven valuable for investigating PimA:

Structural Studies:

  • X-ray crystallography: Used to determine the three-dimensional structure of PimA in complex with GDP-mannose (as in PDB structure 2GEJ)

  • Molecular dynamics (MD) simulations: Employed to study the dynamics of PimA in different ligand-bound states and to understand the conformational changes occurring during catalysis

Functional Assays:

  • Cell-free mannosyltransferase assays: Using radioactive GDP-[14C]mannose to monitor the transfer of mannose to PI

  • Isothermal titration calorimetry (ITC): For measuring binding affinities between PimA and its substrates/products

Computational Methods:

  • Molecular docking: To predict interactions between PimA and its substrates/products

  • MM-GBSA calculations: To estimate binding free energies (ΔGbind) between PimA and various ligands

Researchers have successfully combined these approaches to gain comprehensive insights into PimA function. For instance, MD simulations performed for 300 ns have revealed how different ligand-bound conformations affect PimA dynamics, while docking studies have identified key residues involved in substrate recognition .

What are the optimal conditions for expressing and purifying recombinant PimA?

Based on the successful structural and functional studies reported, recombinant PimA has been effectively expressed in heterologous systems:

  • Expression Systems:

    • Escherichia coli has been successfully used to produce functionally active recombinant PimA

    • The enzyme can be expressed with affinity tags to facilitate purification

  • Purification Strategy:

    • Affinity chromatography (typically using histidine tags)

    • Size exclusion chromatography for further purification

    • Care must be taken to maintain the amphitrophic nature of the enzyme during purification

  • Activity Considerations:

    • PimA is an amphitrophic enzyme that requires proper membrane association for optimal activity

    • The transferase activity is stimulated by high concentrations of non-substrate anionic surfactants, suggesting the importance of lipid-water interfacial conditions for catalysis

For functional studies, it's essential to preserve the membrane-binding properties of PimA, as the N-terminal domain's association with the membrane leads to enzyme activation .

What is the proposed mannose transfer mechanism of PimA?

Based on structural, computational, and mutagenesis studies, the following mechanism for PimA-catalyzed mannose transfer has been proposed:

  • Substrate Binding:

    • GDPM likely binds to PimA first, followed by PI recruitment

    • The binding of both substrates induces a conformational change from "open" to "closed" state

  • Catalytic Transfer:

    • Key residues including Y9, P59, R68, L69, N97, R196, R201, K202, and R228 play crucial roles in the mannosyltransferase activity

    • R201 forms hydrogen bonds with either the phosphate group of PI or the hydroxyl groups of the inositol moiety, facilitating mannose transfer

    • The mannose moiety is transferred from GDPM to the 2-OH position of the myo-inositol ring of PI

  • Product Release:

    • Based on binding energy calculations, PIM is likely released first, followed by GDP

    • This sequence of events prepares PimA for the next catalytic cycle

The enzyme exhibits a GT-B fold typical of glycosyltransferases, with separate domains for binding the nucleotide-sugar donor and the acceptor substrate, allowing for the ordered transfer of the mannose residue .

How do binding energies influence the catalytic cycle of PimA?

MM-GBSA analyses have provided valuable insights into the energetics of PimA interactions with its substrates and products:

LigandΔGbind from MMGBSA analyses (kcal/mol)Kd (μM) from ITCΔGbind = -RTln(Kd) (kcal/mol)
GDPM–26.63 ± 9.940.23–0.87
GDP–36.10 ± 10.170.03–2.08
PI–21.81 ± 9.472.27–0.48
PIM–19.45 ± 6.29NANA
  • GDP binds more strongly to PimA than GDPM, which may drive the mannose transfer reaction forward

  • Based on the ΔGbind values, PIM will likely be released first, followed by GDP when both are bound to PimA

  • The ΔGbind of GDPM is lower than that of PI, indicating that GDPM is probably recruited to PimA first, followed by PI

This ordered binding and release mechanism is consistent with the conformational changes observed in molecular dynamics simulations and helps explain the efficiency of the catalytic cycle.

What conformational changes does PimA undergo during catalysis?

PimA exhibits significant conformational dynamics during its catalytic cycle:

  • Open and Closed States:

    • MD simulations clearly demonstrate that PimA can adopt two distinct conformations: "open" and "closed"

    • The enzyme is most flexible in its free state

    • GDP-bound PimA is the least flexible when a single ligand is bound

    • When both GDPM and PI are bound, PimA shows the least flexibility, indicating that the mannose transfer reaction is facilitated by a closed conformation

  • Domain Movements:

    • Root Mean Square Deviation (RMSD), Radius of gyration (Rg), and Principal Component Analysis (PCA) indicate that free PimA is most flexible, while GDP-bound PimA is most stable

    • The binding of both substrates induces a conformational change that brings the two domains closer together, creating the optimal geometry for catalysis

  • Key Flexible Regions:

    • RMSF (Root Mean Square Fluctuation) analyses show that loop residues 59-70 and the α-helical residues 73-86 play important roles in interacting with both PI and PIM

    • Residue R201 shows higher mobility in the presence of GDPM or PI, possibly facilitating its interaction with the substrates

These conformational changes are essential for PimA function, allowing for proper substrate binding, catalysis, and product release during the enzymatic cycle.

What are the key residues involved in PimA's catalytic mechanism?

Several critical residues have been identified through structural studies, molecular dynamics simulations, and mutagenesis experiments:

  • Catalytic Residues:

    • Y9, P59, R68, L69, N97, R196, R201, K202, and R228 have been identified as playing significant roles in substrate binding and catalysis

    • R201 is particularly important for interacting with the phosphate group of PI or forming hydrogen bonds with the hydroxyl groups of the inositol moiety

  • Membrane Interaction:

    • Residues 59-70 (except L69) show high mobility when PimA is bound to PI or PIM, suggesting their involvement in substrate recruitment or product release

    • Residues 73-86 interact with PI in the presence of GDPM and may be involved in recruiting PI from the inner membrane of mycobacteria

  • Substrate Recognition:

    • Several residues, including 8PYS10, P40, and residues 95EXAP99, interact with the acyl chains of PI or PIM

    • The loop formed by residues 59-70 and residues 124-131 may play important roles in the mannosyltransferase activity by interacting with the acyl chains of substrates

These residues work in concert to create the optimal environment for mannose transfer, ensuring proper substrate orientation and efficient catalysis.

How does PimA interact with the membrane during catalysis?

PimA is an amphitrophic enzyme that associates with the membrane for optimal activity:

  • Membrane Attachment:

    • Based on structural, calorimetric, and mutagenesis studies, PimA attaches to the membrane through its N-terminal domain

    • This membrane association leads to enzyme activation

  • Interfacial Catalysis:

    • PimA binds mono-disperse phosphatidylinositol, but its transferase activity is stimulated by high concentrations of non-substrate anionic surfactants

    • This suggests that the early stages of PIM biosynthesis involve lipid-water interfacial catalysis

    • The enzyme operates at the interface between the aqueous environment (where GDP-mannose is present) and the membrane (where PI is anchored)

  • Substrate Recruitment:

    • MD simulations indicate that residues 73-86 of PimA interact with PI in the presence of GDPM and may be involved in recruiting PI from the inner membrane of mycobacteria

    • The loop residues 59-70 may play a role in binding PI and PIM, potentially facilitating the recruitment of PI to the active site or the release of PIM from the active site

This membrane interaction is crucial for PimA function, allowing it to access its lipid substrate PI and perform the mannosylation reaction at the membrane-water interface.

How can molecular dynamics simulations contribute to understanding PimA function?

Molecular dynamics (MD) simulations have provided valuable insights into PimA function that complement experimental approaches:

  • Conformational Dynamics:

    • MD simulations (run for 300 ns) have revealed the "open to closed" motions of PimA under different ligand-bound conditions

    • These simulations showed that PimA is least dynamic when bound to both GDPM and PI, suggesting the importance of the closed conformation for catalysis

  • Identification of Key Residues:

    • RMSF analyses from MD simulations identified flexible regions and specific residues involved in substrate binding and catalysis

    • Loop residues 59-70 and α-helical residues 73-86 were shown to play important roles in interacting with PI and PIM

    • Residue R201 displayed higher flexibility in the presence of GDPM or PI, suggesting its role in the mannose transfer reaction

  • Binding Energy Estimation:

    • MM-GBSA analyses based on MD trajectories provided estimates of binding free energies between PimA and its ligands

    • These energy calculations helped elucidate the order of substrate binding and product release in the catalytic cycle

MD simulations can be effectively combined with docking studies and experimental approaches to provide a comprehensive understanding of PimA function, guiding the design of inhibitors and advancing structural biology research in this area.

How can PimA be targeted for antimycobacterial drug development?

PimA represents a promising target for developing novel antimycobacterial compounds for several reasons:

  • Essentiality:

    • Direct evidence shows that PimA is essential for the growth of mycobacteria, making it a viable target for drug development

    • The enzyme catalyzes the first mannosylation step in PIM biosynthesis, which is critical for mycobacterial cell envelope integrity

  • Structural Information:

    • The availability of high-resolution structural data (e.g., PDB: 2GEJ) provides a template for structure-based drug design

    • The identification of key residues and binding pockets offers specific targets for inhibitor development

  • Unique Characteristics:

    • PimA's mode of phosphatidylinositol recognition differs from mammalian systems, offering the potential for selective targeting

    • The interfacial nature of PimA catalysis presents opportunities for designing inhibitors that disrupt membrane association or substrate binding

  • Approach to Inhibitor Design:

    • Researchers can design competitive inhibitors that mimic GDP-mannose or PI

    • Allosteric inhibitors targeting the conformational changes of PimA could prevent the enzyme from adopting its catalytically active closed conformation

    • Compounds disrupting the membrane association of PimA through its N-terminal domain could also be effective inhibitors

The development of such inhibitors could lead to novel antimycobacterial drugs with mechanisms distinct from current antibiotics, potentially addressing the growing problem of drug resistance in mycobacterial infections.

How does PimA differ from other mannosyltransferases in structure and mechanism?

PimA possesses distinct characteristics when compared to other mannosyltransferases:

  • Structural Comparison:

    • PimA belongs to the GT-B superfamily of glycosyltransferases, featuring two Rossmann-like domains

    • In contrast, another mannosyltransferase, PimE (Rv1159), belongs to the GT-C superfamily and uses polyprenol-phosphate-mannose as the mannose donor instead of GDP-mannose

    • Alg2, a different mannosyltransferase involved in N-linked glycosylation, is bifunctional, catalyzing both α1,3- and α1,6-mannosylation reactions

  • Donor Substrate Specificity:

    • PimA and PimB' use GDP-mannose as the mannose donor

    • PimE uses polyprenol-phosphate-mannose as the donor

    • Tryptophan C-mannosyltransferase (CMT) uses dolichylphosphate mannose (Dol-P-Man) as the donor substrate

  • Acceptor Recognition:

    • PimA specifically recognizes phosphatidylinositol (PI) and transfers mannose to the 2-OH position of the myo-inositol ring

    • PimB' transfers mannose to the 6-OH position of the myo-inositol ring

    • Tryptophan C-mannosyltransferases recognize WxxW or WxxC consensus sequons in proteins and form unique carbon-carbon bonds between mannose and tryptophan

  • Catalytic Mechanism:

    • PimA operates via an interfacial catalysis mechanism at the membrane-water interface

    • CMT enzymes catalyze an electrophilic aromatic substitution at C2 of the indole in tryptophan, with inversion of configuration at the anomeric carbon of mannose

Understanding these differences is crucial for developing specific inhibitors and for elucidating the diverse roles of mannosyltransferases in various biological systems.

What are the most pressing unanswered questions about PimA that require further research?

Despite significant advances in understanding PimA structure and function, several important questions remain to be addressed:

  • Temporal Dynamics of the Catalytic Cycle:

    • Real-time monitoring of the complete catalytic cycle, including substrate binding, conformational changes, and product release

    • Elucidation of the rate-limiting step in the mannose transfer reaction

  • Membrane Interaction Details:

    • Precise characterization of how PimA interacts with the membrane at the molecular level

    • Determination of how membrane composition affects PimA activity and localization

  • Regulation of PimA Activity:

    • Investigation of potential regulatory mechanisms controlling PimA expression and activity in mycobacteria

    • Exploration of how PimA function is integrated with other steps in PIM, LM, and LAM biosynthesis

  • Development of Specific Inhibitors:

    • Design and optimization of selective PimA inhibitors with antimycobacterial activity

    • Investigation of the effects of PimA inhibition on mycobacterial physiology and virulence

  • Structural Dynamics:

    • Further characterization of PimA conformational changes using techniques such as single-molecule FRET or cryo-EM

    • Determination of additional crystal structures capturing different states in the catalytic cycle

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, molecular biology, and computational methods to further advance our understanding of this essential enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.