Recombinant Gelasinospora sp. Alternative oxidase, mitochondrial (aod-1)

Shipped with Ice Packs
In Stock

Description

Introduction

The mitochondrial electron transport chain (ETC) is essential for cellular energy production via oxidative phosphorylation . In some organisms, alternative components such as alternative oxidase (AOX) provide alternate routes for electron transport . AOX is significant as a response to environmental stressors and is also important during the developmental transitions in the life cycle of an organism . When the cytochrome-mediated mitochondrial electron transport chain is disrupted, the nuclear aod-1 gene induces alternative oxidase .

Function and Mechanism

Alternative oxidase donates electrons directly to oxygen from the ubiquinol pool and is unaffected by chemicals such as antimycin A and KCN, which affect the standard electron transport chain . By providing an alternate terminal point for electron transport, AOX activity makes respiration antimycin-resistant if the classical cytochrome c pathway is compromised . AOX plays a role in lowering mitochondrial reactive oxygen species (ROS) formation in plant cells .

AOD-1 Regulation

When the cytochrome-mediated mitochondrial electron transport chain of Neurospora crassa is disrupted, an alternative oxidase encoded by the nuclear aod-1 gene is induced . Several genes are required for the regulation of aod-1, suggesting the existence of a complex pathway for signaling from the mitochondria to the nucleus and/or for expression of the gene .

Experimental Evidence

  • Inhibition Assays Functional confirmation of AOX in Sporisorium reilianum (SRZ) was achieved through inhibition assays, demonstrating antimycin resistance .

  • Gene Expression Analysis Gene expression analysis has revealed that alternative oxidase plays a prominent role in the teliospore developmental stage, which agrees with favoring alternative respiration during quiescent stages of an organism’s life cycle .

  • Mutant Studies Studies using AOX deletion mutants confirmed that the viability of haploid cells in axenic culture and life cycle progression, as evidenced by mating capability, was not affected by the loss of AOX in the electron transport chain of SRZ .

AOD Mutants

MutantDescription
aod-4Mutations in the aod-4 complementation group were the most frequently isolated, with mutants obtained from both the direct plating method (E1) and the filter enrichment technique (E8, E9, E11, E13, and E14) .
aod-5Each of the other complementation groups contained a single mutant allele .
aod-6The aod-6 mutant strain contained aod-1 transcript under all conditions and AOD1 protein under alternative oxidase inducing conditions, but exhibited little to no KCN-insensitive respiration when grown in the presence of either chloramphenicol or antimycin A . The aod-6 mutation might affect alternative oxidase maturation or assembly rather than the regulation of expression of the aod-1 transcript .
aod-7Each of the other complementation groups contained a single mutant allele .
chl-1The chl-1 mutant strain contained both aod-1 transcript and protein when grown in the presence of antimycin A, but not when grown in chloramphenicol . Thus, chl-1 does not affect alternative oxidase regulation directly but rather confers resistance to chloramphenicol .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aod-1; Alternative oxidase, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
65-362
Protein Length
Full Length of Mature Protein
Species
Gelasinospora sp. (strain S23)
Target Names
aod-1
Target Protein Sequence
LKDFFPAKETAYIRQTPPAWPHHGWTEEEMISVVPEHRKPETVGDWLAWKLVRICRWGTD IATGIRPEQQVDKNHPTTATSADKPLTEAQWLVRFIFLESIAGVPGMVAGMLRHLHSLRR LKRDNGWIETLLEESYNERMHLLTFMKMCEPGLLMKTLILGAQGVFFNAMFLSYLVSPKI THRFVGYLEEEAVHTYTRCIREIEEGHLPKWSDERFEIPEMAVRYWRMPEGKRTMKDLIY YIRADEAVHRGVNHTLSNLDQKEDPNPFVNDYKEGEGGRRPVNPALKPTGFERAEVIR
Uniprot No.

Target Background

Function
This recombinant Gelasinospora sp. Alternative oxidase, mitochondrial (aod-1) catalyzes cyanide-resistant oxygen consumption. It may enhance respiration when the cytochrome respiratory pathway is inhibited or in response to low temperatures.
Protein Families
Alternative oxidase family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein; Matrix side.

Q&A

What is the alternative oxidase (aod-1) in Gelasinospora sp.?

The alternative oxidase, mitochondrial (aod-1) in Gelasinospora sp. is a nuclear-encoded protein that provides an alternative respiratory pathway in mitochondria. Unlike the standard cytochrome-mediated respiratory chain, alternative oxidase allows electron transport to continue when the main pathway is inhibited. The aod-1 gene encoding this protein is part of a conserved molecular mechanism found in fungi within the order Sordariales, including Neurospora crassa and related species . This alternative respiratory pathway has significant implications for mitochondrial function during stress conditions and metabolic adaptation.

How is aod-1 expression regulated at the molecular level?

The expression of aod-1 is primarily regulated through an alternative oxidase induction motif (AIM) located in the promoter region of the gene. This critical regulatory element consists of two CGG repeats separated by 7 base pairs and appears to be the binding site for transcription factors from the Zn(II)2Cys6 binuclear cluster family . The importance of each base within these CGG triplets has been demonstrated through mutation studies, where alterations to any of the six positions within the CGG triplets severely reduced growth of mutant cells in the presence of respiratory chain inhibitors like antimycin A. The AIM functions as a binding site for transcriptional activators that upregulate aod-1 expression in response to mitochondrial respiratory chain inhibition .

What experimental systems are available for studying aod-1 function?

Several experimental systems are available for studying aod-1 function:

Expression SystemCharacteristicsOptimal Applications
E. coliHigh yield, SDS-PAGE purity >85%Protein structure studies, antibody production
E. coli with Avi-tagIn vivo biotinylation via BirA technologyProtein-protein interaction studies, immobilization experiments
YeastEukaryotic expression systemStudies requiring limited post-translational modifications
BaculovirusInsect cell expressionComplex folding requirements, functional studies
Mammalian cellHighest fidelity to native modificationsStudies requiring authentic protein conformation

Source: Product information from recombinant protein suppliers

How should I design experiments to study aod-1 induction in fungal systems?

When designing experiments to study aod-1 induction in fungal systems, consider implementing the following methodological approach:

  • Create a series of plasmid constructs containing the aod-1 structural gene with varying lengths of upstream sequence to identify regulatory regions.

  • Include appropriate selectable markers (such as bleomycin resistance) to confirm successful transformation.

  • Transform these constructs into an aod-1 mutant strain that lacks functional alternative oxidase.

  • Plate transformants on media containing antimycin A, which inhibits the cytochrome-mediated respiratory chain, creating selective pressure for alternative oxidase expression.

  • Assess growth as a functional in vivo assay for alternative oxidase expression—robust growth indicates successful expression.

  • For more precise identification of regulatory elements, create targeted mutations in potential binding sites and evaluate their effect on expression.

  • Confirm findings through conservation analysis in related species within the Sordariales order .

This approach has successfully identified the alternative oxidase induction motif (AIM) in Neurospora crassa and related fungi, including Gelasinospora species .

What methods are recommended for reconstitution and storage of recombinant aod-1 protein?

For optimal reconstitution and storage of recombinant aod-1 protein:

  • Briefly centrifuge the vial containing lyophilized protein prior to opening to bring contents to the bottom.

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% and create working aliquots to prevent repeated freeze-thaw cycles.

  • Store working aliquots at 4°C for up to one week.

  • For long-term storage, maintain frozen aliquots and avoid repeated freezing and thawing as this can significantly reduce protein activity .

How can I determine the transcription start site for the aod-1 gene?

To accurately determine the transcription start site for the aod-1 gene, implement multiple complementary approaches:

  • Construct a cDNA library from poly(A) RNA isolated from cells grown under conditions that induce alternative oxidase expression (e.g., in the presence of chloramphenicol, which inhibits mitochondrial translation).

  • Isolate multiple cDNA clones representing the 5'-end of alternative oxidase transcripts.

  • Sequence these clones to identify the transcription start site(s).

  • Use PCR-based approaches to isolate additional clones representing the 5'-end of transcripts for more comprehensive analysis.

  • Analyze multiple independent clones, as research in Neurospora crassa has revealed that aod-1 may have multiple transcription start sites rather than a single defined site .

In previous studies of N. crassa, analysis of 48 independent clones identified 20 different transcription start sites for the aod-1 gene, suggesting flexibility in transcription initiation .

How does aod-1 activity interact with the standard respiratory chain?

The alternative oxidase provides a bypass to complexes III and IV of the standard respiratory chain, accepting electrons directly from the ubiquinone pool and reducing oxygen to water. This interaction with the respiratory chain has several important characteristics:

  • AOX activation is triggered by a highly reduced redox status of the respiratory chain, functioning as a regulatory mechanism that responds to the electron transport chain's condition.

  • The enzyme remains essentially inactive under normal respiratory conditions but becomes engaged when the main respiratory chain is inhibited or overwhelmed.

  • Pyruvate enhances AOX activity, providing a metabolic regulation mechanism that links respiratory chain function to central carbon metabolism.

  • When expressed in heterologous systems, such as human cells, AOX confers remarkable resistance to cyanide, which typically inhibits cytochrome c oxidase (complex IV) of the standard respiratory chain .

This interaction allows mitochondria to maintain electron flow and oxygen consumption even when the cytochrome pathway is compromised, providing metabolic flexibility and stress resistance .

What is the evolutionary conservation of the AIM regulatory element across fungal species?

The alternative oxidase induction motif (AIM) shows remarkable conservation among fungi within the order Sordariales but diverges in more distantly related species:

Fungal SpeciesOrderCGG-N7-CGG Motif ConservationRelative Position to TATA Box
Neurospora crassaSordarialesPerfectly conservedConserved
N. intermediaSordarialesPerfectly conservedConserved
N. sitophilaSordarialesPerfectly conservedConserved
N. tetraspermaSordarialesPerfectly conservedConserved
Gelasinospora sp.SordarialesPerfectly conservedConserved
Podospora anserinaSordarialesPerfectly conservedConserved
Chaetomium globosumSordarialesPerfectly conservedConserved
Fusarium graminearumHypocrealesNot presentNot applicable
Magnaporthe griseaMagnaporthalesNot presentNot applicable

This conservation pattern suggests that the CGG-N7-CGG motif serves as a critical regulatory element specifically within the Sordariales lineage, while different regulatory mechanisms may have evolved in other fungal orders .

How can heterologous expression of aod-1 be utilized as a research tool in mitochondrial studies?

Heterologous expression of aod-1 offers significant potential as a research tool in mitochondrial studies:

  • Expression of alternative oxidase in systems naturally lacking this pathway (such as human cells) confers spectacular resistance to inhibitors of the conventional respiratory chain, including cyanide.

  • This property makes AOX expression valuable for limiting the deleterious consequences of respiratory chain deficiency in experimental models.

  • The fact that AOX remains inactive unless triggered by a highly reduced redox state of the respiratory chain makes it particularly suitable for studying respiratory chain dysfunction without interfering with normal respiration.

  • AOX expression can serve as a tool to distinguish between the effects of electron transport inhibition and those of ATP production limitation.

  • Since pyruvate enhances AOX activity, the system can also be used to study metabolic regulation of respiratory function .

These properties make heterologous AOX expression a promising approach for investigating mitochondrial diseases, aging processes, and fundamental aspects of mitochondrial physiology .

How can I distinguish between aod-1 activity and cytochrome pathway respiration?

To differentiate between alternative oxidase (aod-1) activity and the conventional cytochrome pathway in respiratory measurements:

  • Use specific inhibitors in respirometry experiments:

    • Add antimycin A or cyanide to inhibit the cytochrome pathway (complex III or IV)

    • Use salicylhydroxamic acid (SHAM) to specifically inhibit alternative oxidase

  • Design sequential inhibition protocols:

    • Measure baseline respiration

    • Add cytochrome pathway inhibitors to reveal AOX-dependent respiration

    • Add SHAM to confirm that the remaining respiration is AOX-dependent

  • Test the effect of pyruvate addition, which specifically enhances alternative oxidase activity

  • In genetic systems, compare respiration in wild-type, aod-1 mutant, and complemented strains under various inhibitor treatments

  • When using alternative oxidase in heterologous systems like human cells, measure respiration in the presence of cyanide, which will be maintained only in cells expressing functional alternative oxidase .

What factors might affect the reproducibility of aod-1 induction experiments?

Several factors can influence the reproducibility of aod-1 induction experiments:

  • Variation in transcription start sites: Studies have shown that the aod-1 gene uses multiple transcription start sites, which may affect the consistency of expression measurements if primers or probes target specific regions near the 5' end .

  • Specificity of inducing conditions: The precise concentration and duration of exposure to respiratory inhibitors like antimycin A or chloramphenicol can significantly impact induction levels.

  • Genetic background effects: Mutations in other genes involved in mitochondrial function or stress response pathways may influence aod-1 induction.

  • Growth phase and metabolic state: The redox status of the respiratory chain varies with growth phase and carbon source, affecting the baseline and inducible expression of aod-1.

  • Media composition: Specific nutrients, particularly those affecting pyruvate levels, can influence alternative oxidase activity and potentially its expression.

  • Environmental factors: Temperature, oxygen availability, and other environmental conditions may affect the mitochondrial stress response.

To enhance reproducibility, carefully standardize growth conditions, inducer concentrations, exposure times, and harvest points .

How does alternative oxidase research relate to mitochondrial disease models?

Alternative oxidase research has significant relevance to mitochondrial disease models:

  • Since AOX provides an alternative electron route that bypasses complexes III and IV of the respiratory chain, it potentially offers a therapeutic approach for diseases involving deficiencies in these complexes.

  • Expression of alternative oxidase in human cells has been demonstrated to confer cyanide resistance to mitochondrial substrate oxidation, suggesting potential applications in addressing cytochrome c oxidase deficiencies .

  • The ability of AOX to reduce oxidative stress by preventing over-reduction of respiratory complexes may be beneficial in mitochondrial diseases characterized by increased reactive oxygen species production.

  • The finding that AOX expression is well tolerated in human cells opens possibilities for developing genetic therapies for mitochondrial cytopathies .

  • Understanding the regulatory mechanisms of alternative oxidase in fungi can provide insights into general stress response pathways in mitochondria across species.

How can findings from fungal aod-1 research contribute to understanding broader respiratory adaptation mechanisms?

Research on fungal aod-1 contributes to understanding broader respiratory adaptation mechanisms in several ways:

  • The identification of the alternative oxidase induction motif (AIM) in Gelasinospora and related fungi reveals evolutionarily conserved mechanisms for responding to respiratory chain inhibition .

  • The presence of alternative respiratory pathways across different kingdoms (fungi, plants, and some metazoans) but their absence in others (including humans) highlights different evolutionary solutions to maintaining metabolic flexibility.

  • The regulation of alternative oxidase by pyruvate demonstrates integration between central carbon metabolism and respiratory chain function .

  • The finding that AOX remains inactive unless triggered by specific conditions (highly reduced respiratory chain) illustrates sophisticated regulatory mechanisms that allow organisms to optimize energy production while maintaining metabolic flexibility.

  • Conservation analysis of the AIM regulatory element across fungal species provides insights into the evolution of stress response pathways in eukaryotes .

This research ultimately illuminates how organisms balance efficiency, flexibility, and stress resistance in their energy metabolism systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.