Recombinant Gemmatimonas aurantiaca Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; GAU_1533; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505)
Target Names
uppP
Target Protein Sequence
MTVWQAIVLGIVQGLTEPLPVSSSAHLALTPYFLGWSDPGLAFDVALHFGTLLALIWYFR REWLEMIASAWRIARTRRVETVHDRRVLYLIAATIPGGIGGLLLNDLAETTFRSPVVIAT SLIVMGILLWAVDRWSARARVLEEVTLRDAIIVGCAQVLALVPGVSRSGSTMTAGRLLKL DRPSVARFSFLMSMPITLAAVIVKMPDAVREHGASLPLLAGVAAAAVSSWFAISVLLRYV ARHSFGVFAVYRVLLGIVVFATLASRT
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Gemmatimonas aurantiaca and why is it ecologically significant?

Gemmatimonas aurantiaca belongs to the phylum Gemmatimonadota, which ranks among the eight most abundant bacterial phyla in soil environments, comprising approximately 6.5% of total 16S rRNA gene sequences in soils . This organism has gained significant attention due to its widespread distribution across diverse environments. Beyond soil habitats, Gemmatimonadota have been detected in marine environments, including deep oceanic trenches like the Mariana Trench, where they show remarkably high relative abundances (13.30% in rRNA libraries), indicating substantial ecological activity . The type strain G. aurantiaca T-27 (DSM 14586 / JCM 11422 / NBRC 100505) serves as a model organism for studying this phylum's unique physiological characteristics and environmental adaptations.

What are the key metabolic capabilities that distinguish Gemmatimonas aurantiaca?

Gemmatimonas aurantiaca exhibits remarkably diverse metabolic capabilities that contribute to its ecological success. Most notably, G. aurantiaca possesses the unexpected ability to perform anoxygenic photosynthesis via a type 2 photosynthetic reaction center . This photosynthetic capability was a groundbreaking discovery, as G. aurantiaca represents a previously unknown photosynthetic bacterial lineage outside the traditional photosynthetic groups. The organism contains bacteriochlorophyll a and carotenoids as its main photosynthetic pigments, but unlike photoautotrophs, it lacks carbon fixation pathways and performs photoheterotrophy instead . Additionally, G. aurantiaca possesses atypical nosZ genes involved in nitrous oxide reduction, suggesting an important role in nitrogen cycling and potentially in regulating greenhouse gas emissions . These metabolic versatilities help explain the organism's success across diverse environmental niches.

What is Undecaprenyl-diphosphatase (uppP) and what cellular functions does it perform?

Undecaprenyl-diphosphatase (uppP) is an integral membrane enzyme that plays a critical role in bacterial cell wall biosynthesis. The protein catalyzes the dephosphorylation of undecaprenyl pyrophosphate to form undecaprenyl phosphate, a crucial lipid carrier involved in peptidoglycan synthesis. In G. aurantiaca, uppP consists of 254 amino acids with multiple transmembrane regions, as evidenced by its highly hydrophobic sequence profile . The amino acid sequence (MTVWQAIVLGIVQGLTEPLPVSSSAHLALTPYFLGWSDPGLAFDVALHFGTLLALIWYFRREWLEMIASAWRIARTRRVETVHDRRVLYLIAATIPGGIGGLLLNDLAETTFRSPVVIATSLIVMGILLWAVDRWSARARVLEEVTLRDAIIVGCAQVLALVPGVSRSGSTMTAGRLLKLDRPSVARFSFLMSMPITLAAVIVKMPDAVREHGASLPLLAGVAAAAVSSWFAISVLLRYVARHSFGVFAVYRVLLGIVVFATLASRT) contains characteristic motifs conserved among uppP enzymes . This enzyme represents a potential target for antimicrobial development, as it participates in a pathway essential for bacterial survival.

What are the optimal conditions for recombinant expression of G. aurantiaca uppP?

For successful recombinant expression of G. aurantiaca uppP, researchers should consider several critical factors. As a hydrophobic membrane protein, uppP presents particular challenges for expression and purification. Based on general membrane protein methodologies and the limited specific information available:

  • Expression systems: E. coli BL21(DE3) with specialized vectors containing membrane protein fusion tags (such as MBP or SUMO) may enhance solubility and proper folding.

  • Induction conditions: Lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) often yield better results for membrane proteins by slowing expression and allowing proper membrane insertion.

  • Membrane extraction: Selective detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations slightly above their critical micelle concentration are recommended for solubilizing uppP while maintaining its native conformation.

When working with the commercially available recombinant form, storage in Tris-based buffer with 50% glycerol at -20°C is recommended, with avoidance of repeated freeze-thaw cycles to maintain enzymatic activity .

How can researchers measure the enzymatic activity of recombinant uppP?

Measuring uppP enzymatic activity requires specialized techniques due to its membrane-associated nature and the lipid substrates involved. Several methodological approaches can be employed:

  • Radioisotope-based assays: Using radiolabeled undecaprenyl pyrophosphate (14C or 32P) as substrate, followed by thin-layer chromatography (TLC) separation and quantification of the dephosphorylated product.

  • Colorimetric phosphate detection: After the enzymatic reaction, released inorganic phosphate can be quantified using malachite green or other phosphate detection reagents.

  • HPLC-based methods: High-performance liquid chromatography with appropriate detection methods (UV or mass spectrometry) can separate and quantify substrate and product.

  • Coupled enzyme assays: Systems linking uppP activity to easily measurable secondary reactions provide continuous monitoring capabilities.

For all these methods, careful consideration of reaction conditions is essential, including pH (typically 7.5-8.5), temperature (30-37°C), and the presence of divalent cations (Mg2+ or Mn2+) that often serve as cofactors for phosphatase activity.

What are the recommended storage and handling procedures for maintaining uppP stability?

Maintaining the stability and activity of recombinant uppP requires careful handling procedures. Based on available information, the following approaches are recommended:

  • Storage temperature: The protein should be stored at -20°C for routine use, with -80°C recommended for long-term storage to minimize degradation .

  • Buffer composition: A Tris-based buffer system with 50% glycerol provides optimal stability. The high glycerol content prevents freeze-damage and helps maintain proper protein folding .

  • Working aliquots: To avoid repeated freeze-thaw cycles which can significantly reduce activity, prepare small working aliquots that can be stored at 4°C for up to one week .

  • Handling precautions: As a membrane protein, uppP is susceptible to aggregation. Avoid vigorous shaking or vortexing, and maintain the presence of appropriate detergents at concentrations above their critical micelle concentration when the protein is in solution.

  • Quality control: Regular assessment of protein integrity via SDS-PAGE and enzymatic activity assays is recommended, particularly for aged stocks or after any modifications to storage conditions.

How can recombinant uppP be utilized to study bacterial cell wall biosynthesis pathways?

Recombinant G. aurantiaca uppP offers valuable opportunities for investigating bacterial cell wall biosynthesis through several research approaches:

  • Inhibitor screening and characterization: The purified enzyme can serve as a target for screening potential inhibitors, providing insights into structure-activity relationships and mechanism-based drug design. This is particularly relevant given the importance of cell wall biosynthesis as an antibiotic target.

  • Reconstitution studies: Incorporating uppP into artificial membrane systems along with other cell wall biosynthetic enzymes enables the study of coordinated pathway functions and regulatory interactions in a controlled environment.

  • Structural biology applications: Purified uppP can be used for crystallization trials or cryo-electron microscopy to determine three-dimensional structures, offering insights into catalytic mechanisms and substrate recognition.

  • Mutagenesis approaches: Site-directed mutagenesis of conserved residues can help identify critical amino acids involved in catalysis or substrate binding, advancing understanding of enzyme mechanism.

  • Comparative enzymology: Characterizing kinetic parameters and substrate specificity of G. aurantiaca uppP compared to homologs from other bacteria can reveal adaptations specific to the Gemmatimonadota phylum.

These approaches can collectively advance understanding of peptidoglycan biosynthesis regulation, which remains incompletely understood despite its fundamental importance to bacterial physiology.

What insights can G. aurantiaca uppP provide regarding evolutionary adaptations in Gemmatimonadota?

The study of G. aurantiaca uppP offers a unique window into the evolutionary adaptations within the Gemmatimonadota phylum. Several research directions can yield valuable insights:

What methodological approaches can address the knowledge gaps in understanding G. aurantiaca's cell wall biosynthesis?

Several methodological approaches can help address existing knowledge gaps regarding G. aurantiaca's cell wall biosynthesis:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data can provide comprehensive insights into the regulation and operation of cell wall biosynthesis pathways under different environmental conditions. This approach is particularly valuable given the diverse ecological contexts in which Gemmatimonadota thrive .

  • In situ labeling techniques: Developing fluorescent probes or click-chemistry compatible substrates for uppP and related enzymes would enable visualization of active cell wall biosynthesis in living G. aurantiaca cells. Fluorescence in situ hybridization (FISH) techniques, as applied to other Gemmatimonadota , could be adapted for this purpose.

  • Genetic manipulation systems: Developing efficient transformation protocols for G. aurantiaca would enable gene knockout, knockdown, or overexpression studies targeting uppP and related enzymes, allowing direct assessment of their physiological roles.

  • Cell wall compositional analysis: Detailed chemical characterization of G. aurantiaca cell wall components under various growth conditions could reveal unique features that might correlate with uppP functionality and regulation.

  • Heterologous expression systems: Expressing G. aurantiaca cell wall biosynthesis genes including uppP in model organisms with well-established genetic tools could facilitate functional studies when direct manipulation of G. aurantiaca proves challenging.

What are common challenges in working with recombinant G. aurantiaca uppP and how can they be addressed?

Working with recombinant G. aurantiaca uppP presents several technical challenges common to membrane proteins, along with specific considerations:

ChallengePotential SolutionsRationale
Low expression yields1. Optimize codon usage for expression host
2. Test different fusion tags (MBP, SUMO, GST)
3. Evaluate specialized expression strains (C41/C43)
Membrane proteins often express poorly; these strategies can improve translation efficiency and protein stability
Protein aggregation1. Express at lower temperatures (16-20°C)
2. Screen different detergents for solubilization
3. Include glycerol (10-20%) in buffers
Slower expression and appropriate detergents help maintain native conformation
Loss of activity during purification1. Include lipid additives in purification buffers
2. Minimize exposure to air/oxidation
3. Use gentle purification methods
Membrane proteins often require lipid environment for stability; oxidation can affect critical residues
Inconsistent activity measurements1. Standardize substrate preparation
2. Control detergent:protein ratios
3. Include positive controls in assays
Activity can be influenced by substrate presentation and protein microenvironment
Crystallization difficulties1. Try lipidic cubic phase methods
2. Screen detergent/lipid combinations
3. Consider antibody fragment co-crystallization
Membrane proteins often require specialized crystallization approaches

When encountering specific difficulties not addressed in this table, researchers should consider consulting specialized literature on membrane protein biochemistry and potentially adapting methods used for related phosphatase enzymes.

How can researchers differentiate between uppP activity and other phosphatase activities in complex samples?

Differentiating uppP activity from other phosphatases in complex samples requires selective approaches:

  • Substrate specificity: Undecaprenyl pyrophosphate is a relatively specific substrate for uppP. Using this natural substrate or close structural analogs can help distinguish uppP activity from other phosphatases that typically act on smaller or more hydrophilic substrates.

  • Inhibitor profiles: Develop a panel of inhibitors with differential effects on uppP versus other phosphatases. For example, bacitracin specifically complexes with undecaprenyl pyrophosphate and can inhibit uppP activity, while having minimal effects on many other phosphatases.

  • Detergent sensitivity: As a membrane enzyme, uppP activity depends on appropriate detergent conditions, whereas many soluble phosphatases maintain activity across a broader range of detergent concentrations and types.

  • Immunological approaches: Develop specific antibodies against G. aurantiaca uppP for immunoprecipitation or depletion experiments to selectively remove or isolate the enzyme from complex mixtures.

  • Genetic approaches: In systems amenable to genetic manipulation, targeted gene deletion or silencing of uppP can provide a negative control to distinguish its activity from background phosphatase activities.

  • Kinetic analysis: Detailed kinetic characterization including pH profiles, metal ion dependencies, and reaction to specific phosphatase inhibitors can help differentiate uppP from other phosphatases when using mixed substrates.

What controls should be included when studying G. aurantiaca uppP in relation to photosynthetic capabilities?

When investigating potential relationships between uppP function and G. aurantiaca's unique photosynthetic capabilities, several critical controls should be implemented:

  • Light/dark cultivation comparisons: Since G. aurantiaca exhibits photoheterotrophic growth , comparing uppP expression and activity in cultures grown under light versus dark conditions can reveal potential light-dependent regulation.

  • Growth phase controls: Sample across different growth phases, as photosynthetic apparatus assembly may vary with culture age, potentially affecting cell envelope properties and uppP demands.

  • Spectroscopic confirmation: Verify the presence and integrity of photosynthetic complexes (using absorption spectra at 770-880 nm for bacteriochlorophyll a) in parallel with uppP studies to establish temporal relationships between photosynthetic activity and cell wall modifications .

  • Temperature controls: Since G. aurantiaca grows optimally at 25-28°C under reduced oxygen conditions , maintain strict temperature controls when comparing uppP function across conditions to avoid confounding effects.

  • Oxygen concentration series: Since G. aurantiaca grows under semiaerobic conditions (5-10% oxygen) , test uppP expression and activity across an oxygen gradient to distinguish direct light effects from oxygen-mediated responses.

  • Non-photosynthetic mutants: If available, compare uppP function in wild-type versus photosynthesis-deficient mutants to establish whether observed effects are directly linked to photosynthetic activity or represent independent responses.

  • Heterologous expression: Express G. aurantiaca uppP in both photosynthetic and non-photosynthetic host organisms to determine if the cellular context of photosynthetic machinery affects uppP function.

What are the key knowledge gaps in understanding the relationship between uppP and antibiotic resistance in Gemmatimonadota?

Several critical knowledge gaps exist regarding uppP and antibiotic resistance in Gemmatimonadota:

  • Resistance mechanism characterization: While Gemmatimonadota have been observed to show resistance to antibiotics including ampicillin, penicillin, bacitracin, and chloramphenicol , the specific role of uppP in these resistance mechanisms remains unexplored. Bacitracin specifically targets the undecaprenyl phosphate cycle, suggesting uppP may play a direct role in resistance.

  • Structural adaptations: Whether G. aurantiaca uppP possesses unique structural features that confer inherent resistance to antibiotics targeting cell wall biosynthesis requires investigation through comparative structural analysis with sensitive bacterial species.

  • Expression regulation: How uppP expression responds to antibiotic exposure in Gemmatimonadota is unknown. Transcriptomic and proteomic studies under antibiotic challenge could reveal regulatory mechanisms contributing to resistance.

  • Horizontal gene transfer: Whether resistance-associated variants of uppP have been horizontally transferred within Gemmatimonadota, similar to the photosynthesis gene cluster , could provide insights into the evolution of resistance traits.

  • Cell wall modifications: The relationship between uppP activity and potential modifications to peptidoglycan structure that might contribute to antibiotic resistance in Gemmatimonadota remains unexplored.

  • Environmental adaptation: How uppP function in Gemmatimonadota has adapted to diverse environments from soil to marine habitats , potentially contributing to differing antibiotic susceptibility profiles across the phylum.

How might uppP function relate to the ecological success of Gemmatimonadota across diverse environments?

The ecological success of Gemmatimonadota across diverse environments may be partially explained by adaptations in uppP function:

  • Membrane fluidity adaptation: uppP plays a crucial role in cell envelope biogenesis, which directly impacts membrane fluidity. As Gemmatimonadota inhabit environments ranging from soil to marine systems to deep ocean trenches , uppP adaptations may enable appropriate membrane characteristics for each niche.

  • Stress response integration: Cell wall remodeling is a common bacterial stress response. uppP regulation may be integrated with the diverse metabolic capabilities of Gemmatimonadota (including photosynthesis, methane oxidation, and nitrous oxide reduction) , allowing rapid adaptation to changing environmental conditions.

  • Nutrient acquisition: Cell envelope properties influence nutrient uptake. In oligotrophic environments like marine systems, uppP-mediated modifications to cell surface structures could optimize nutrient acquisition strategies.

  • Resistance to environmental stressors: Beyond antibiotics, cell wall properties affect resistance to various environmental stressors including osmotic shock, desiccation, and pH fluctuations. uppP adaptations may contribute to the remarkable environmental tolerance of Gemmatimonadota.

  • Biofilm formation: Cell surface properties influence attachment and biofilm formation. uppP-mediated changes in cell envelope composition might contribute to the observed preference of G. aurantiaca strain AP64 for an "attachment-to-solid surface lifestyle" , potentially explaining its successful colonization of diverse surface types.

  • Interactions with other microorganisms: Cell surface properties dictate inter-species interactions. uppP-mediated envelope modifications may help Gemmatimonadota establish beneficial interactions or resist competition in complex microbial communities.

What interdisciplinary approaches could advance understanding of G. aurantiaca uppP in relation to global biogeochemical cycles?

Advancing our understanding of G. aurantiaca uppP in relation to global biogeochemical cycles requires innovative interdisciplinary approaches:

  • Metatranscriptomics integrated with biogeochemical measurements: Correlating uppP expression levels in environmental Gemmatimonadota populations with real-time measurements of nitrogen, carbon, and other elemental cycles could reveal functional relationships, particularly given their roles in methane oxidation and nitrous oxide reduction .

  • Isotope probing techniques: Using stable isotope probing combined with uppP-targeted molecular approaches could track how uppP activity relates to carbon and nitrogen utilization in situ, providing insights into the functional role of G. aurantiaca in ecosystem processes.

  • Climate change simulation experiments: Investigating uppP expression and activity under simulated climate change conditions (elevated CO2, altered precipitation, temperature increases) could reveal how cell envelope modifications might contribute to Gemmatimonadota's responses to global environmental changes.

  • Synthetic ecology approaches: Constructing defined microbial communities with wild-type and uppP-modified G. aurantiaca could elucidate how cell envelope properties influence community functions related to biogeochemical transformations.

  • Comparative genomics across environmental gradients: Analyzing uppP sequence variations across Gemmatimonadota from different biogeochemically relevant environments (such as agricultural soils, pristine ecosystems, and marine sediments) could identify adaptive signatures linked to specific biogeochemical processes.

  • Integration with Earth system models: Incorporating mechanistic understanding of how uppP-mediated cell envelope adaptations affect Gemmatimonadota's biogeochemical functions could improve predictive models of microbial contributions to global elemental cycles.

  • Development of biosensors: Creating uppP-based biosensors for monitoring Gemmatimonadota activity in environmental samples could provide real-time data on their contributions to biogeochemical processes across diverse ecosystems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.