Recombinant General secretion pathway protein B (exeB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant General Secretion Pathway Protein B (ExeB)

ExeB is an inner membrane protein involved in the type II secretion pathway in Gram-negative bacteria . This pathway is essential for the translocation of proteins across both the cytoplasmic and outer membranes in a two-step process . The secretion of toxins and other virulence factors relies on the ExeAB complex, where ExeB partners with ExeA to facilitate this process .

Interaction with ExeA

The ExeA protein contains a consensus ATP-binding site, and mutations within this site significantly reduce the rate of toxin secretion . The interaction between ExeA and ExeB is critical for the function of the type II secretion system .

  • ATP Binding: ExeA likely uses ATP to provide energy for the secretion process, suggesting that ATP binding by ExeA is required for ExeA-ExeB complex formation .

  • Hydrolysis: Hydrolysis is required for its function in secretion once established .

Role in Protein Secretion

ExeB, in conjunction with ExeA, plays a crucial role in protein secretion . The ExeAB complex is essential for the energy-dependent secretion of proteins like aerolysin in Aeromonas hydrophila .

  • Secretion Mechanism: The ExeAB complex likely transduces metabolic energy to facilitate the opening of a secretion port in the outer membrane, enabling the translocation of proteins .

  • Requirement for ExeA: ExeB's function is heavily reliant on its interaction with ExeA, as evidenced by the instability of ExeB in the absence of ExeA .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
exeB; General secretion pathway protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Aeromonas hydrophila
Target Names
exeB
Target Protein Sequence
MSTLLKALRRAEQPQFTPHIPAMGLPVTQEEEQNRRWIWWLLAPLALLMGAGANYGWHLL NNRPIEKTVEVKEVVTPPFVRVEPRPMITRPLPPPLPEPVVRPRVTPNDSAPAANGSQGL AERIMNALNSTPLMEETAPQAQSESQAMPISALPLELKQRVPPLAYGSHVFSSNPAKRAV MLNGREFREGSEVAPGVTLIAIAQDYIILQVAGQNVSLKALQDWRG
Uniprot No.

Target Background

Function

Involved in the general secretion pathway (GSP) for protein export.

Protein Families
ExeB/OutB/PulB family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.