Recombinant General secretion pathway protein B (pulB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

If a specific tag type is required, please inform us; we will prioritize development accordingly.
Synonyms
pulB; General secretion pathway protein B; Pullulanase operon protein PULB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-174
Protein Length
full length protein
Species
Klebsiella pneumoniae
Target Names
pulB
Target Protein Sequence
MLVRPQEPYPQSEPPAAVGRMVQIPYVTVPLYAALLIALGWFGGEQWRNKPEPQPMRQSV AHAALVPLNQPAVKAAVAPVNAGPEIQAEPEIAIDEDNLPPLRYSAHVYASLADKRSIVL NGQSWKEGDSPLANLVIEHIQQDLTVFSFNGKTFTLAALDDWPGGAIEESPQAE
Uniprot No.

Target Background

Protein Families
ExeB/OutB/PulB family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is General secretion pathway protein B (pulB) and what organism is it natively found in?

General secretion pathway protein B (pulB) is a protein involved in the secretion systems of certain bacteria. It is natively found in Klebsiella pneumoniae as indicated by its UniProt entry (P20725) . The protein is also known by its alternative name, Pullulanase operon protein pulB. The full-length protein comprises 174 amino acids and plays a critical role in the general secretion pathway, which is responsible for transporting proteins across the bacterial cell envelope .

How does pulB relate to other bacterial secretion systems?

PulB functions within the context of bacterial secretion systems, which are critical for protein transport across bacterial membranes. Based on our understanding of bacterial secretion pathways, pulB likely operates within either Type II or Type III secretion systems. The Type II secretion system (T2SS) typically involves a two-step process, where proteins first cross the inner membrane via the Sec or Tat pathways and then are secreted across the outer membrane .

Unlike the Type I secretion system (T1SS), which bypasses the periplasm during protein secretion (thereby reducing physiological impact on the cell), systems involving pulB likely include periplasmic intermediates. This is significant for recombinant protein production as it affects protein folding, modification, and potential stress on the host cell .

What experimental approaches can be used to optimize recombinant pulB expression and secretion?

Optimizing recombinant pulB expression and secretion requires a multi-faceted approach:

  • Signal Sequence Optimization: N-terminal signal sequences are crucial for translocation into the periplasm. During this process, signal sequences and methionine are removed, leading to an authentic N-terminus of the recombinant protein. This can be critical for maintaining protein activity and stability .

  • Expression System Selection: When selecting an expression system, consider whether a one-step or two-step secretion system is most appropriate. One-step systems (like T1SS) bypass the periplasm, reducing physiological impact on the cell, while two-step systems may allow for better folding but increase cellular stress .

  • Fusion Tag Strategy: For some secretion systems, fusion to specific domains is essential. For example, in the HlyA T1SS, fusion to the nontoxic 50-60 amino acid HlyA C-terminal domain is required to induce protein translocation. A longer C-terminal HlyA sequence may facilitate protein secretion due to glycine-rich repeats upstream of the signal sequence .

  • Codon Optimization: Evaluate the impact of codon usage on expression efficiency, as the rate of translation elongation and transcript stability can significantly affect secretion rates .

  • Host Strain Engineering: Consider using leaky mutants or strains specifically engineered for enhanced secretion. The extracellular protein concentration can potentially be increased to more than 10 g/L with almost 100% secretion efficiency through appropriate strain engineering .

How can researchers address common challenges in pulB purification and characterization?

Several methodological approaches can address challenges in pulB purification and characterization:

  • Optimization of Storage Conditions: Store recombinant pulB at -20°C, and for extended storage, conserve at -20°C or -80°C. Avoid repeated freezing and thawing, and store working aliquots at 4°C for up to one week to maintain protein stability .

  • Buffer Optimization: Use Tris-based buffers with 50% glycerol, optimized specifically for pulB stability and function .

  • Tag Selection Strategy: The choice of tag for protein purification should be determined during the production process based on protein-specific characteristics. Different tags may affect folding, solubility, and function of the recombinant pulB .

  • Contamination Assessment: Implement rigorous quality control to assess potential contamination with host cell proteins. Since E. coli secretes relatively few native proteins extracellularly, secretion-based approaches can significantly reduce the amount of contaminating host proteins, thereby simplifying downstream processing .

  • Activity Assays: Develop functional assays specific to pulB to assess whether the recombinant protein maintains its native activity, particularly if modifications to the expression system or purification protocol are implemented.

What are the considerations for designing experiments to study pulB's role in protein secretion pathways?

When designing experiments to investigate pulB's role in protein secretion:

  • Comparison with Other Secretion Systems: Compare pulB-mediated secretion with other established secretion systems. For instance, researchers have successfully secreted various proteins using the HlyA T1SS, including GFPuv, β-galactosidase from E. coli, cutinase from Thermobifida fusca, and others with different degrees of purity and yield .

  • Mutation Analysis: Design systematic mutations in pulB to identify critical residues or domains essential for its function. This can provide insights into the mechanism of pulB-mediated secretion.

  • Interaction Studies: Investigate potential protein-protein interactions between pulB and other components of the secretion machinery using techniques such as co-immunoprecipitation, yeast two-hybrid assays, or crosslinking studies.

  • Secretion Kinetics: Develop assays to quantify secretion rates and efficiency under different conditions, including varying expression levels, temperature, pH, and media composition.

  • Structural Analysis: Consider structural biology approaches (X-ray crystallography, cryo-EM, or NMR) to understand pulB's three-dimensional structure and how it facilitates protein secretion.

What are the optimal conditions for producing recombinant pulB with high yield and purity?

To achieve high yield and purity in recombinant pulB production:

  • Expression System Selection: Choose an appropriate secretion system based on the target protein's characteristics. Different secretion systems have shown varying efficiencies for different proteins. For example, the flagellar T3SS has demonstrated protein secretion with up to 15 mg/L and more than 50% purity for certain proteins .

  • Cell Lysis Considerations: Be aware that cell lysis can sometimes be mistaken for protein secretion. Implement proper controls and analytical methods to distinguish between true secretion and protein release due to cell lysis .

  • Scale-up Strategy: Develop a systematic scale-up strategy that maintains optimal conditions identified in small-scale experiments. Consider bioreactor parameters such as dissolved oxygen, pH, temperature, and feeding strategies.

  • Purification Protocol: Implement a multi-step purification protocol that may include:

    • Initial clarification by centrifugation or filtration

    • Capture step using affinity chromatography based on the chosen tag

    • Intermediate purification using ion exchange chromatography

    • Polishing step using size exclusion chromatography

    • Buffer exchange to final storage buffer (Tris-based buffer with 50% glycerol)

  • Quality Assessment: Conduct rigorous quality assessment using techniques such as SDS-PAGE, Western blotting, mass spectrometry, and activity assays to ensure the final product meets the required specifications.

How can researchers effectively compare different secretion systems for pulB-related studies?

To effectively compare different secretion systems:

  • Standardized Metrics: Establish standardized metrics for comparison, including:

    • Secretion efficiency (percentage of total protein secreted)

    • Yield (mg/L of culture)

    • Purity (percentage of target protein in secreted fraction)

    • Impact on host cell physiology and growth

    • Protein integrity and activity

  • Controlled Experimental Design: Ensure all systems are compared under identical conditions, including:

    • Same host strain background

    • Identical culture conditions (media, temperature, induction parameters)

    • Equivalent gene copy number and promoter strength when possible

    • Standardized analytical methods

  • Multi-system Comparison Table: Create a comparative analysis using a structured approach as shown in the table below:

Secretion SystemSecretion EfficiencyYield (mg/L)Purity (%)Impact on HostProtein IntegrityBest Suited For
Type I (HlyA)VariableModerateVariable (can exceed 50%)ModerateMaintains C-terminal fusionProteins tolerant of C-terminal tags
Type II (Sec-dependent)Up to 100% with optimizationCan exceed 10 g/LModerateHighAuthentic N-terminusProteins requiring proper folding
Type III (Flagellar)VariableUp to 15 mg/LCan exceed 50%LowDepends on similarity to FliCProteins similar to flagellar components

What analytical techniques are most appropriate for characterizing pulB structure and function?

For comprehensive characterization of pulB:

  • Structural Analysis:

    • Circular Dichroism (CD) Spectroscopy for secondary structure assessment

    • Nuclear Magnetic Resonance (NMR) for solution structure determination

    • X-ray Crystallography for high-resolution structural analysis

    • Cryo-Electron Microscopy (cryo-EM) for visualizing large complexes

  • Functional Analysis:

    • In vitro secretion assays with purified components

    • Fluorescent protein fusion assays to track secretion in real-time

    • Site-directed mutagenesis to identify functional residues

    • Cross-linking studies to identify interaction partners

  • Biophysical Characterization:

    • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS) for oligomeric state determination

    • Differential Scanning Calorimetry (DSC) for thermal stability analysis

    • Surface Plasmon Resonance (SPR) for interaction studies

    • Isothermal Titration Calorimetry (ITC) for binding affinity determination

  • Computational Methods:

    • Molecular Dynamics simulations to understand conformational dynamics

    • Homology modeling if structural data is limited

    • Sequence analysis for conserved domains and motifs

    • Docking studies to predict protein-protein interactions

How should researchers approach data inconsistencies in pulB functional studies?

When facing data inconsistencies:

  • Systematic Error Identification: Evaluate potential sources of systematic errors, including:

    • Protein preparation methods

    • Assay conditions and reagents

    • Equipment calibration

    • Environmental variables

  • Statistical Approach: Apply appropriate statistical methods to determine if inconsistencies are statistically significant. Consider using:

    • Spearman test for correlation analysis

    • Mann-Whitney test for non-parametric comparisons

    • ANOVA for multiple group comparisons

    • Statistical power analysis to ensure adequate sample sizes

  • Literature Comparison: Compare results with existing literature and consider what might explain differences. For example, in the study of dental pulp lesions, one study found a 68.62% correspondence between clinical and pathological diagnosis, while another reported just 49.54% .

  • Replication Strategy: Implement a structured replication strategy:

    • Internal replication with larger sample sizes

    • Replication using alternative methodologies

    • Independent replication by different laboratory members

    • External replication through collaborations

  • Sensitivity Analysis: Perform sensitivity analysis to determine how variations in experimental parameters affect outcomes and identify the most critical variables influencing results.

What are the best practices for designing controls in pulB secretion experiments?

Essential controls for pulB secretion experiments include:

  • Positive Controls:

    • Well-characterized proteins known to be efficiently secreted by the same system

    • Fusion constructs with validated secretion signals

    • Positive control strains with known secretion phenotypes

  • Negative Controls:

    • Non-secreted cytoplasmic proteins to detect cell lysis

    • Constructs lacking essential secretion signals

    • Secretion-deficient host strains

  • Cellular Compartment Controls:

    • Markers for different cellular compartments (cytoplasm, periplasm, membrane, extracellular)

    • Lysis controls to distinguish true secretion from protein release due to cell lysis

  • Experimental Process Controls:

    • Time-course controls to monitor secretion kinetics

    • Growth phase controls to account for effects of cell density

    • Media composition controls to assess effects of environmental factors

  • Technical Controls:

    • Loading controls for protein quantification

    • Standard curves for quantitative assays

    • Internal reference genes for RNA expression analysis

How can researchers effectively integrate structural and functional data to understand pulB mechanism?

To effectively integrate structural and functional data:

  • Structure-Function Correlation:

    • Map functional domains onto structural models

    • Correlate conserved residues with functional importance

    • Design targeted mutations based on structural insights

    • Assess how structural changes affect function

  • Multi-scale Modeling Approach:

    • Develop atomic-level models of individual domains

    • Create coarse-grained models of larger assemblies

    • Integrate models into cellular context

    • Simulate dynamic processes across different time scales

  • Integrated Data Visualization:

    • Create interactive visualizations that combine structural and functional data

    • Develop heat maps showing functional impacts of mutations on structural elements

    • Generate pathway diagrams incorporating structural information

  • Collaborative Interdisciplinary Analysis:

    • Bring together expertise in structural biology, biochemistry, cell biology, and computational modeling

    • Implement regular cross-disciplinary discussions to interpret complex datasets

    • Develop shared conceptual frameworks for data interpretation

  • Incremental Model Development:

    • Start with simplified models based on limited data

    • Refine models as new data becomes available

    • Test model predictions experimentally

    • Iterate between computational prediction and experimental validation

What emerging technologies could advance our understanding of pulB in secretion pathways?

Several emerging technologies hold promise for advancing pulB research:

  • CRISPR-Cas9 Genome Editing:

    • Precise modification of pulB and related genes in native contexts

    • High-throughput screening of genetic variants

    • Development of reporter systems for real-time monitoring of secretion

  • Single-Molecule Techniques:

    • Single-molecule FRET to observe conformational changes

    • Super-resolution microscopy to visualize secretion machinery in situ

    • Optical tweezers to measure forces involved in protein translocation

  • Synthetic Biology Approaches:

    • Design of minimal secretion systems

    • Creation of orthogonal secretion pathways

    • Development of tunable secretion modules

  • Advanced Computational Methods:

    • Machine learning for prediction of optimal secretion conditions

    • Molecular simulations with enhanced sampling techniques

    • Systems biology models of secretion pathways

  • Microfluidic Technologies:

    • High-throughput screening of secretion parameters

    • Single-cell analysis of secretion dynamics

    • Continuous monitoring of secretion process

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.