Recombinant Geobacillus kaustophilus ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
atpF; GK3362; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Geobacillus kaustophilus (strain HTA426)
Target Names
atpF
Target Protein Sequence
MWKANVWVLGEAAHGISGGTIIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIANEIDQ AEKRRQEAEKLLEEQRELMKQSRQEAQALIENARKLAEEQKEQIVASARAEAERVKEVAK KEIEREKEQAMAALREQVASLSVLIASKVIEKELTEQDQRKLIEAYIKDVQEAGGAR
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-embedded proton channel F0 domain, linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
Database Links

KEGG: gka:GK3362

STRING: 235909.GK3362

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

How does the thermophilic nature of G. kaustophilus influence its ATP synthase structure compared to mesophilic bacteria?

The thermophilic nature of G. kaustophilus necessitates structural adaptations for enzyme stability at high temperatures. Comparative analyses of ATP synthases from thermophiles (including Bacillus PS3 and Caldalaklibacillus thermarum) versus mesophiles (E. coli, Paracoccus denitrificans, and chloroplast) reveal interesting differences:

Structural FeatureThermophilic ATP SynthasesMesophilic ATP Synthases
Packing densityNo significant differenceNo significant difference
Loop lengthNo consistent shorteningVariable
Ionic interactionsIncreased numberFewer

Notably, the increased ionic interactions in thermophilic ATP synthases appear to be critical for stabilizing these complexes at elevated temperatures . This suggests that G. kaustophilus atpF likely participates in additional stabilizing interactions that maintain structural integrity under thermophilic conditions.

What expression systems are most effective for producing recombinant G. kaustophilus ATP synthase subunits?

E. coli expression systems have proven effective for the recombinant production of G. kaustophilus ATP synthase subunits. Current protocols typically employ:

  • Expression vectors containing N-terminal or C-terminal His-tags for purification

  • Induction optimization in E. coli host strains

  • Purification to >90% homogeneity as determined by SDS-PAGE

  • Stable storage in Tris-based buffer with 6% trehalose at pH 8.0

For optimal results with G. kaustophilus atpF specifically, expression in E. coli followed by purification results in a stable preparation suitable for structural and functional studies . Recommended storage conditions include aliquoting with 5-50% glycerol for long-term storage at -20°C/-80°C to prevent repeated freeze-thaw cycles that can compromise protein integrity .

How can researchers distinguish between different conformational states of G. kaustophilus ATP synthase during the catalytic cycle?

Capturing the dynamic conformational changes in G. kaustophilus ATP synthase requires advanced structural techniques. Based on studies of related bacterial ATP synthases, researchers should consider:

  • Cryo-electron microscopy (cryo-EM) to visualize distinct rotational states, as demonstrated with Bacillus PS3 ATP synthase where three rotational states were captured, allowing construction of atomic models

  • X-ray crystallography with specific catalytic state-locking approaches:

    • ADP-beryllium fluoride (ADP-BeF3-) to trap ATP-bound-like states

    • Aluminum fluoride compounds to capture transition state analogs

    • Non-hydrolyzable ATP analogs to stabilize specific conformations

  • Site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy to monitor subunit movement during catalysis

The conformational states of the catalytic β subunits in G. kaustophilus likely adopt 'open', 'closed', and 'open' conformations similar to those observed in Bacillus PS3 F1-ATPase, which differs from the 'half-closed', 'closed', and 'open' conformations seen in E. coli and the 'closed', 'closed', and 'open' conformations in chloroplast and mitochondrial ATP synthases .

What insights can be gained from studying ATP synthase inhibition mechanisms in G. kaustophilus?

Investigation of inhibition mechanisms provides valuable information about ATP synthase function and potential antimicrobial targets. Key insights include:

  • Differential inhibitor sensitivity between species: For example, efrapeptin inhibits ATP synthases from mitochondria, chloroplasts, and some bacteria, including thermophilic Bacillus strain PS3

  • Binding site characterization: Efrapeptin binds in the central cavity of F1 lined with βE, αE, αTP, and the γ subunit, stabilized by hydrophobic interactions and hydrogen bonds

  • Mechanistic understanding: Efrapeptin prevents the βE subunit from converting into a nucleotide-binding conformation, blocking the catalytic cycle

  • Subunit-specific targeting: Recent studies have focused on ε subunit-targeted inhibitors identified through in silico screening methods

The study of G. kaustophilus ATP synthase inhibition could reveal thermophile-specific mechanisms that might differ from mesophilic counterparts, providing new avenues for selective antimicrobial development.

How does the c-ring stoichiometry in G. kaustophilus ATP synthase affect its bioenergetic efficiency?

While G. kaustophilus c-ring stoichiometry hasn't been definitively determined in the available literature, studies of related Bacillus species provide important insights:

In Bacillus pseudofirmus OF4, c-ring stoichiometry can vary between c11 to c15, with c13 being optimal for growth at high pH (>10) . The c-ring stoichiometry directly influences the ion-to-ATP ratio and therefore the bioenergetic efficiency of the enzyme.

ATP Synthase Sourcec-ring StoichiometryImplications
B. pseudofirmus WTc13Optimal for high pH growth
B. pseudofirmus mutantsc12Reduced capacity to grow on limiting malate at high pH
G. kaustophilusLikely c9-c13Predicted based on related species

The c-ring stoichiometry determines how many protons must flow through the ATP synthase to generate one ATP molecule, directly affecting cellular bioenergetics. For G. kaustophilus, which thrives in thermophilic environments, the c-ring stoichiometry may be evolutionarily optimized for energy conservation under high-temperature conditions .

What are the most effective methods for reconstituting functional G. kaustophilus ATP synthase for in vitro studies?

For functional reconstitution of G. kaustophilus ATP synthase, researchers should consider:

  • Liposome preparation:

    • Use lipid compositions that mimic bacterial membranes (phosphatidylethanolamine, phosphatidylglycerol, cardiolipin)

    • Control size distribution through extrusion through polycarbonate filters

    • Optimize lipid-to-protein ratio (typically 20:1 to 100:1 w/w)

  • Reconstitution techniques:

    • Detergent-mediated reconstitution with gradual detergent removal via Bio-Beads or dialysis

    • Direct incorporation during liposome formation for selected subunits

    • Fusion of proteoliposomes containing separate F0 and F1 sectors

  • Functional verification:

    • ATP synthesis assays using artificially generated proton gradients

    • ATP hydrolysis measurements with coupled enzyme assays

    • Proton pumping assays using pH-sensitive fluorescent dyes

This approach has proven effective for reconstituting archaeal ATP synthases, allowing measurement of ATP synthesis at physiologically relevant membrane potentials (90-150 mV) . For G. kaustophilus specifically, its thermostability may require optimization of reconstitution conditions, potentially including thermostable lipids and higher temperature handling.

How can researchers assess the structural stability of recombinant G. kaustophilus atpF under various experimental conditions?

Multiple complementary techniques can assess the structural stability of recombinant G. kaustophilus atpF:

  • Thermal stability assessment:

    • Differential scanning calorimetry (DSC) to determine melting temperature

    • Circular dichroism (CD) spectroscopy to monitor secondary structure changes with temperature

    • Intrinsic fluorescence spectroscopy to detect tertiary structure alterations

  • Chemical stability analysis:

    • Resistance to denaturants using isothermal chemical denaturation curves

    • Protease resistance assays under varying conditions

    • Aggregation propensity using dynamic light scattering

  • Functional stability evaluation:

    • Long-term storage testing at different temperatures

    • Activity retention after multiple freeze-thaw cycles

    • Stability in various buffer systems and pH ranges

As a thermophilic protein, G. kaustophilus atpF is expected to demonstrate significant stability advantages compared to mesophilic homologs, particularly regarding retention of structure at elevated temperatures and resistance to chemical denaturants.

What approaches are most effective for studying interactions between G. kaustophilus atpF and other ATP synthase subunits?

To characterize subunit interactions within the G. kaustophilus ATP synthase complex:

  • For direct interaction studies:

    • Pull-down assays using tagged atpF to identify binding partners

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • For structural interaction analysis:

    • Chemical cross-linking coupled with mass spectrometry to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify protected regions

    • Site-directed mutagenesis of predicted interface residues followed by interaction studies

  • For in silico approaches:

    • Homology modeling based on related bacterial ATP synthase structures

    • Molecular docking simulations between atpF and potential partner subunits

    • Molecular dynamics simulations to evaluate stability of modeled interactions

Understanding these interactions is particularly important as the peripheral stalk components, including atpF, play critical roles in maintaining the structural integrity of the ATP synthase complex during the catalytic cycle.

How do pH-dependent conformational changes in G. kaustophilus ATP synthase subunits influence enzyme function?

Recent research has revealed that pH can significantly influence ATP binding and conformational changes in ATP synthase subunits, particularly the ε subunit . For G. kaustophilus ATP synthase:

  • Mechanistic implications:

    • pH may alter the positioning of catalytic residues

    • Protonation states of key amino acids likely influence subunit interactions

    • Conformational equilibria between different states may shift with pH

  • Experimental approaches:

    • pH-dependent activity assays to determine optimal functional pH range

    • Structural studies at varying pH to capture different conformational states

    • Molecular dynamics simulations incorporating different protonation states

  • Subunit-specific effects:

    • The ε subunit demonstrates pH-dependent ATP binding

    • Other subunits, including atpF, may also exhibit pH-responsive structural changes

    • Inter-subunit interactions could be strengthened or weakened by pH changes

For thermophilic G. kaustophilus, these pH dependencies may be particularly important for maintaining ATP synthase function under extreme conditions where pH homeostasis is challenging.

What are the challenges in determining the minimal driving force required for ATP synthesis in G. kaustophilus ATP synthase?

Determining the minimal driving force for ATP synthesis presents several technical challenges:

  • Measurement limitations:

    • Accurately controlling small membrane potential differences

    • Distinguishing ATP synthesis from background ATP contamination

    • Maintaining stable proteoliposome preparations during measurements

  • Thermophilic considerations:

    • Temperature effects on membrane integrity and proton permeability

    • Altered thermodynamics of ATP synthesis at elevated temperatures

    • Potential unique adaptations in G. kaustophilus ATP synthase

Recent studies with archaeal ATP synthases demonstrated ATP synthesis at physiologically relevant driving forces of 90-150 mV, lower than previously thought possible . For G. kaustophilus, similar studies would be valuable, particularly examining whether its thermophilic adaptations influence the minimal driving force required for ATP synthesis.

How might structural studies of G. kaustophilus ATP synthase inform the design of novel antimicrobial compounds?

Structural studies of G. kaustophilus ATP synthase could significantly advance antimicrobial development:

  • Target identification:

    • Mapping bacterial-specific structural features absent in human ATP synthases

    • Identifying critical residues for function that differ from human counterparts

    • Characterizing unique binding pockets suitable for selective inhibitor design

  • Mechanism-based approaches:

    • Understanding the conformational changes during catalysis to target transition states

    • Identifying allosteric sites that could be exploited for inhibition

    • Characterizing the binding modes of known inhibitors like efrapeptin

  • Structure-guided design:

    • Using computational methods for virtual screening against identified target sites

    • Structure-activity relationship studies based on binding site architecture

    • Fragment-based approaches focused on bacterial-specific pockets

  • Thermophilic advantages:

    • Increased protein stability facilitates structural studies

    • Higher-resolution structures may be possible compared to mesophilic homologs

    • Identified inhibitors might have broad applicability against other bacterial species

Recent studies have successfully used in silico screening to identify novel ATP synthase inhibitors targeting the ε subunit , demonstrating the potential of structure-based approaches for discovering new antimicrobial compounds that target this essential enzyme.

How does G. kaustophilus ATP synthase subunit b (atpF) differ from homologous proteins in other bacterial species?

Comparative analysis of G. kaustophilus atpF with homologs from other bacteria reveals significant insights:

SpeciesatpF LengthKey Structural FeaturesFunctional Implications
G. kaustophilus177 aaHydrophobic N-terminal region; Extended alpha-helical C-terminal domainThermostable peripheral stalk component
E. coli156 aaSimilar domain organization but shorterMesophilic adaptation
Bacillus PS3~170 aaHigh similarity to G. kaustophilusAlso thermophilic; similar stability features
Mycobacterium species~160 aaUnique features inhibiting ATP hydrolysisDifferent regulatory mechanism

The G. kaustophilus atpF sequence (MWKANVWVLGEAAHGISGGTIIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIANEIDQAEKRRQEAEKLLEEQRELMKQSRQEAQALIENARKLAEEQKEQIVASARAEAERVKEVAKKEIEREKEQAMAALREQVASLSVLIASKVIEKELTEQDQRKLIEAYIKDVQEAGGAR) contains features consistent with its role in the peripheral stalk, including a transmembrane domain and an extended helical region .

Key differences likely relate to thermostability adaptations, with enhanced ionic interactions compared to mesophilic counterparts , and potential species-specific regulatory functions.

What insights can transglycosylation studies in G. kaustophilus provide about its metabolic versatility?

While not directly related to ATP synthase function, studies on G. kaustophilus transglycosylation activities reveal additional aspects of this organism's metabolic capabilities:

G. kaustophilus demonstrates significant transglycosylation activity, synthesizing modified nucleosides like floxuridine at rates up to 52 mg·L-1·h-1 using whole cells . This activity is enhanced by:

  • The presence of 1 mmol·L-1 ZnCl2

  • Optimal substrate ratios (5:1 5'Fdri to 2'dur)

  • Efficient utilization of both 6-oxo- and 6-aminopurine nucleotides as substrates

The thermostable enzymes from G. kaustophilus, including purine nucleoside phosphorylase, make it attractive for industrial bioprocesses involving nucleoside modifications. This versatility in handling diverse substrates parallels the adaptability required for ATP synthase to function optimally in thermophilic environments.

How do regulatory mechanisms of ATP synthase differ between G. kaustophilus and other bacterial species?

Regulatory mechanisms of ATP synthase show significant variation across bacterial species:

  • ε subunit regulation:

    • In many bacteria, the ε subunit regulates ATP hydrolytic function

    • In mycobacteria, ATP synthesis is favored over hydrolysis through specific regulatory mechanisms

    • G. kaustophilus likely has thermophile-specific regulatory adaptations

  • pH-dependent regulation:

    • The binding of ATP to the ε subunit can be pH-dependent, influencing regulatory function

    • The optimal c-ring stoichiometry may vary with pH, as seen in Bacillus pseudofirmus OF4

  • Ion specificity and coupling:

    • Most bacterial ATP synthases use H+ as the coupling ion

    • Some extremophiles use Na+ instead of or in addition to H+

    • The ion specificity affects the regulatory properties and energy coupling efficiency

  • Redox regulation:

    • While primarily found in chloroplast ATP synthases , some bacterial ATP synthases may have redox-responsive elements

    • G. kaustophilus, as a thermophile, may have unique regulatory mechanisms adapted to extreme conditions

Understanding these regulatory differences is crucial for characterizing the complete functional profile of G. kaustophilus ATP synthase and potentially exploiting these differences for biotechnological applications or antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.