Recombinant Geobacillus kaustophilus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it for preferential development.
Synonyms
mscL; GK1370; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Geobacillus kaustophilus (strain HTA426)
Target Names
mscL
Target Protein Sequence
MWNEFKKFAIRGNVIDLAVGVIIGGAFGKIVSSLVNDIIMPLVGLILGGINFSDLSWKVG KAEVKYGAFIQTVVDFLIIAFSIFLFVKLINTLYERVKKQEEVKETAPTLTKEEELLTEI RDLLKQQRETT
Uniprot No.

Target Background

Function

This protein is a large-conductance mechanosensitive channel (mscL) from Geobacillus kaustophilus. It functions as a membrane channel that opens in response to membrane tension. It is believed to play a role in regulating cellular osmotic pressure.

Database Links

KEGG: gka:GK1370

STRING: 235909.GK1370

Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Large-conductance Mechanosensitive Channel (MscL) in Geobacillus kaustophilus?

The Large-conductance Mechanosensitive Channel (MscL) in Geobacillus kaustophilus is a membrane protein that responds to mechanical forces by opening pores in the cell membrane. MscL forms a homopentameric structure with each subunit containing two transmembrane regions, similar to MscL proteins found in other bacteria . The channel opens in response to stretch forces in the lipid bilayer, functioning via a bilayer mechanism triggered by hydrophobic mismatch and changes in membrane curvature or transbilayer pressure profile . In G. kaustophilus, which thrives at elevated temperatures (50-75°C), this protein plays a critical role in osmoregulation and preventing cell lysis during osmotic shock, as it does in other microorganisms, but with adaptations for thermostability.

How does G. kaustophilus MscL differ from mesophilic MscL proteins?

G. kaustophilus MscL has evolved specific adaptations for functioning at high temperatures (50-75°C) while maintaining structural integrity and mechanosensitive properties. Although the core mechanosensing function remains similar to mesophilic bacteria, thermophilic MscL proteins typically exhibit higher thermostability through increased hydrophobic interactions, salt bridges, and optimized protein packing. The amino acid composition likely features a higher proportion of charged residues and fewer thermolabile residues compared to mesophilic homologs. These adaptations enable G. kaustophilus MscL to maintain membrane integrity during temperature fluctuations while preserving mechanosensitivity at elevated temperatures that would denature mesophilic proteins.

What is the genomic context of the mscL gene in G. kaustophilus?

The mscL gene in G. kaustophilus exists within a genome characterized by a relatively high GC content (49-53%) . Genomic analysis reveals that Geobacillus species generally maintain an open pan-genome, suggesting continued evolution and adaptation . The G. kaustophilus genome contains genes associated with stress tolerance, including those for acid/bile resistance, osmotic stress resistance, and oxidative stress management , which work in concert with MscL to enable survival in challenging environments. Notably, G. kaustophilus appears to lack significant mobile genetic elements such as plasmids, prophages, and insertion sequences , suggesting the mscL gene is likely part of the core genome rather than acquired through horizontal gene transfer.

What are the most effective systems for expressing recombinant G. kaustophilus MscL?

The most effective expression systems for recombinant G. kaustophilus MscL utilize either E. coli or B. subtilis as host organisms. For E. coli-based systems, using expression vectors containing thermostable selection markers (such as kanamycin resistance genes derived from thermophiles) can improve selection efficiency . When expressing in B. subtilis, a mobilizable B. subtilis-G. kaustophilus shuttle plasmid system can be particularly effective, as demonstrated with the pGK1 plasmid that carries elements for selection and replication in Geobacillus . This expression system should incorporate a strong, preferably inducible promoter, and the dam methylase gene of E. coli, which has been shown to be indispensable for efficient transformation . For optimal results, expression should be conducted at temperatures that balance protein folding (30-37°C) with subsequent functional verification at temperatures mimicking the native G. kaustophilus environment (50-75°C).

What transformation protocols work best for G. kaustophilus genetic manipulation to study MscL?

Traditional transformation methods are often inefficient for Geobacillus species, but recent advances have developed effective alternatives. A conjugation-based method using the pLS20cat plasmid has proven particularly successful . This system involves:

  • Construction of a mobilizable shuttle plasmid (e.g., pGK1) carrying the mscL gene and necessary selection markers

  • Preparation of a B. subtilis donor strain harboring pLS20cat, expressing the E. coli dam methylase gene and the conjugation-stimulating rapLS20 gene

  • Co-culturing of donor B. subtilis and recipient G. kaustophilus cells, with optimal results achieved when recipient cells are in exponential growth phase

  • Selection of transformants using thermostable antibiotic markers

Additionally, a chromosome-based transfer system has been developed, where artificial DNA segments (containing the mscL gene) are designed on the B. subtilis chromosome and transferred via pLS20-mediated conjugation, resulting in genomic integration in G. kaustophilus through homologous recombination . This approach takes advantage of the plasticity of the B. subtilis genome and the simplicity of pLS20 conjugation transfer, offering flexible options for studying MscL in its native context.

What purification strategies yield functional G. kaustophilus MscL protein for structural and functional studies?

Purification of functional G. kaustophilus MscL requires specialized approaches to maintain protein stability and functionality throughout the process. An optimized protocol includes:

  • Expression with a cleavable affinity tag (His6 or Strep-tag) for initial purification

  • Cell lysis under mild conditions (preferably using non-ionic detergents like DDM or LDAO)

  • Membrane isolation and solubilization with detergents proven effective for thermostable membrane proteins

  • Affinity chromatography at room temperature to maintain protein folding

  • Size exclusion chromatography to obtain homogeneous protein preparations

  • Optional reconstitution into liposomes or nanodiscs for functional studies

Throughout the purification process, including glycerol (10-15%) and appropriate detergent concentrations is crucial to prevent protein aggregation. For functional verification, the purified protein can be incorporated into artificial membranes for patch-clamp electrophysiology studies, ensuring that the thermostable properties and mechanosensitive function remain intact after purification.

How can electrophysiological methods be adapted for studying thermostable MscL proteins?

Studying thermostable MscL proteins like those from G. kaustophilus requires significant modifications to standard electrophysiological techniques. A comprehensive approach involves:

  • Temperature-controlled patch-clamp setups capable of maintaining stable recordings at 50-75°C

  • Modified patch pipette glass compositions that maintain seal integrity at higher temperatures

  • Heat-stable lipid compositions for artificial membranes or liposomes that mimic the native G. kaustophilus membrane environment

  • Buffer systems with minimal pH changes across the experimental temperature range

  • Precisely calibrated pressure application systems to account for thermal effects on membrane tension

To address the technical challenges of high-temperature electrophysiology, researchers can use alternative approaches such as fluorescence-based assays with temperature-stable fluorophores to monitor channel activity, or implement reconstituted systems in planar lipid bilayers with temperature control. These adaptations allow for accurate measurement of channel conductance, gating thresholds, and kinetics under conditions that reflect the native environment of G. kaustophilus MscL.

What techniques are available for studying G. kaustophilus MscL structure-function relationships?

Investigating structure-function relationships in G. kaustophilus MscL requires a multifaceted approach combining molecular and biophysical techniques:

  • Site-directed mutagenesis to introduce specific changes in transmembrane regions, followed by functional assessment

  • Cysteine scanning mutagenesis combined with accessibility studies to map channel conformation during gating

  • FRET-based approaches using strategically placed fluorophores to monitor conformational changes

  • Molecular dynamics simulations parameterized for high temperatures to predict structural changes during gating

  • Cryo-EM or X-ray crystallography to determine high-resolution structures of the channel in different conformational states

When designing these experiments, special consideration must be given to the thermophilic nature of G. kaustophilus MscL. Mutagenesis studies should account for both the functional role of specific residues and their contribution to thermostability. Researchers should compare results with homologous residues in mesophilic MscL proteins to identify thermophile-specific adaptations that maintain channel function at elevated temperatures.

How does the lipid environment affect G. kaustophilus MscL gating properties at high temperatures?

The lipid environment significantly influences the gating properties of G. kaustophilus MscL, particularly at the elevated temperatures of its native habitat. Research approaches to investigate this relationship include:

  • Reconstitution of purified MscL into liposomes with varying lipid compositions to determine optimal functional conditions

  • Systematic testing of membrane thickness, fluidity, and curvature parameters at different temperatures (30-75°C)

  • Analysis of lipid-protein interactions using EPR spectroscopy or fluorescence techniques

  • Comparison of native G. kaustophilus membrane lipids with synthetic membranes to identify critical lipid components

G. kaustophilus, like other thermophiles, likely contains more saturated fatty acids and unique lipid modifications that maintain appropriate membrane fluidity at high temperatures. These adaptations would influence MscL gating tension thresholds through hydrophobic matching between the protein and the lipid bilayer. Understanding these relationships provides insights into how mechanosensitive channels have evolved to function in extreme environments while maintaining precise tension sensitivity .

What are the potential biotechnological applications of G. kaustophilus MscL?

G. kaustophilus MscL offers several promising biotechnological applications, leveraging its thermostability and mechanosensitive properties:

  • Biosensors for mechanical forces that can operate at elevated temperatures in industrial processes

  • Controlled release systems for drug delivery triggered by specific mechanical stimuli

  • Cell-based bioreactors with regulated molecular release controlled by mechanical tension

  • Templates for designing synthetic mechanosensitive channels with tailored gating properties

  • Models for understanding and potentially targeting similar channels in thermophilic pathogens

The thermostable nature of G. kaustophilus MscL makes it particularly valuable for applications requiring stability in harsh conditions. Additionally, understanding the mechanosensing properties of this channel contributes to the broader field of mechanobiology and could inform strategies for combating multiple drug-resistant bacterial strains, as suggested by research on MscL pharmacological potential .

How can researchers overcome protein stability issues when working with recombinant G. kaustophilus MscL?

Working with recombinant G. kaustophilus MscL presents stability challenges that can be addressed through several targeted approaches:

  • Expression optimization: Adjust induction conditions (temperature, inducer concentration, duration) to favor proper folding over high yield

  • Buffer optimization: Include stabilizing agents such as glycerol (10-20%), specific divalent cations, or mild solubilizing agents

  • Detergent selection: Test multiple detergent types and concentrations, focusing on those known to work well with thermophilic membrane proteins

  • Storage conditions: Implement flash-freezing in small aliquots and store with cryoprotectants to maintain activity through freeze-thaw cycles

  • Handling protocols: Minimize exposure to air-water interfaces by avoiding excessive agitation or bubbling during purification

When expressed in mesophilic hosts (E. coli or B. subtilis), recombinant G. kaustophilus proteins often require a balance between the expression conditions suitable for the host and the final conditions needed for protein stability. Using fusion partners that enhance solubility or co-expression with chaperones specific to thermophilic proteins can significantly improve success rates.

What are the best approaches for resolving contradictory results in G. kaustophilus MscL functional studies?

When faced with contradictory results in G. kaustophilus MscL functional studies, researchers should implement a systematic troubleshooting approach:

  • Standardize experimental conditions: Create detailed protocols specifying temperature, pressure application rates, buffer compositions, and membrane preparations

  • Confirm protein integrity: Verify the structural integrity of the purified protein using circular dichroism, thermal shift assays, or limited proteolysis

  • Control for lipid environment variables: Systematically test different lipid compositions and document their effects on channel behavior

  • Validate expression constructs: Sequence verification of expression constructs to confirm the absence of mutations that could affect function

  • Cross-validate using multiple techniques: Combine electrophysiology with fluorescence-based assays or other independent methods to confirm observations

Additionally, researchers should consider species-specific adaptations when comparing results between different MscL homologs. Contradictory findings may reflect genuine biological differences rather than methodological errors, particularly when comparing thermophilic and mesophilic MscL variants. Collaborative cross-laboratory validation studies can help establish consensus on experimental approaches specific to thermostable mechanosensitive channels.

How might G. kaustophilus MscL contribute to our understanding of membrane protein evolution in extremophiles?

G. kaustophilus MscL represents an excellent model for studying the evolution of membrane proteins in extremophiles. Research in this area can be advanced through:

  • Comparative genomic analyses across thermophilic, mesophilic, and psychrophilic species with identified MscL homologs

  • Ancestral sequence reconstruction to identify key evolutionary transitions in MscL adaptation to high temperatures

  • Experimental testing of evolutionary hypotheses through chimeric proteins combining domains from thermophilic and mesophilic MscL variants

  • Correlation of genomic adaptations with membrane composition differences across species

The genomic analysis of Geobacillus species indicates an open pan-genome with variability in genes linked to environmental interaction , suggesting ongoing adaptation processes. Studies comparing conserved mechanosensing mechanisms across temperature ranges could reveal fundamental principles of membrane protein adaptation to extreme environments, while potentially identifying minimal necessary modifications for thermostability. This research connects to broader studies of protein evolution under extreme conditions and could inform protein engineering strategies.

What role does MscL play in the stress response network of G. kaustophilus?

Understanding the integrated role of MscL within the broader stress response network of G. kaustophilus requires systems biology approaches:

  • Transcriptomic analysis under various stress conditions (osmotic, heat, oxidative) to identify co-regulated genes

  • Proteomic studies to map protein-protein interactions between MscL and other stress response proteins

  • Creation of knockout or conditional mutants (using the newly developed transformation methods ) to assess phenotypic consequences

  • Metabolomic profiling to identify changes in cellular metabolism during channel activation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.