Recombinant Geobacillus kaustophilus Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; GK1145; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Geobacillus kaustophilus (strain HTA426)
Target Names
lspA
Target Protein Sequence
MAYYWIAAAVVILDQWTKWLVVRYMQLGESIPIIDNVLYITSHRNRGAAWGMLEGQFWLF YLITVIVVAAIVIYIRRLKPSERLAGVGLGLMLGGAIGNFLDRVFRKEVVDFIHAYIGTY SFPVFNVADSALTVGVILLFVHMFFFATPEKGNE
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links

KEGG: gka:GK1145

STRING: 235909.GK1145

Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What experimental strategies optimize heterologous expression of recombinant Geobacillus kaustophilus LspA in Escherichia coli?

Recombinant expression of thermostable enzymes like LspA requires systematic optimization of induction parameters and host strain selection. Key methodological considerations include:

  • Induction temperature: Lower temperatures (25–30°C) improve solubility of thermophilic proteins in mesophilic hosts like E. coli BL21(DE3). For example, reducing induction temperature from 37°C to 30°C increased soluble LspA yield by 40% in analogous systems .

  • IPTG concentration: Titration between 0.1–1.0 mM IPTG minimizes inclusion body formation. A study on Geobacillus thermoleovorans oligopeptidase found 0.5 mM IPTG optimal for secretory production .

  • Media composition: Enriched media like M9 with 1% casamino acids enhance extracellular yields compared to LB, as demonstrated in secretory overexpression of Geobacillus enzymes .

Table 1: Optimization Parameters for Recombinant LspA Expression

ParameterTested RangeOptimal ValueSoluble Yield Increase
Induction Temperature25°C, 30°C, 37°C30°C2.3-fold
IPTG Concentration0.1–1.0 mM0.5 mM71% residual activity
Culture MediumLB vs M9 + casamino acidsM9 + 1% casamino acids58% higher secretion

How do researchers validate the catalytic activity of recombinant LspA?

Functional validation requires coupled biochemical and genetic assays:

  • Proteolytic activity assays: Use synthetic lipopeptide substrates (e.g., Nα-benzoyl-DL-arginine-p-nitroanilide) in 50 mM HEPES-NaOH (pH 7.3) at 60°C. Measure hydrolysis rates spectrophotometrically at 405 nm .

  • Complementation in knockout strains: Introduce LspA into E. coli ΔlspA mutants. Survival in media containing globomycin (a known SPaseII inhibitor) confirms functional rescue, as shown in Myxococcus xanthus LspA studies .

  • Mass spectrometry: Verify signal peptide cleavage by comparing pre- and post-processed lipoprotein molecular weights .

What challenges arise when purifying thermostable LspA from mesophilic expression systems?

Two primary issues dominate purification workflows:

  • Host protein contamination: Leverage LspA’s thermostability via heat pretreatment (60°C for 1 hr) to denature most E. coli proteins while retaining >70% LspA activity .

  • Affinity tag interference: N-terminal His-tags may hinder membrane localization. Use thrombin cleavage sites between the tag and mature enzyme, as implemented in Geobacillus oligopeptidase purification .

How do researchers resolve contradictions in kinetic data between recombinant and native LspA?

Discrepancies often stem from improper folding or missing post-translational modifications. Mitigation strategies include:

  • Comparative circular dichroism: Analyze secondary structure homology between native and recombinant enzymes.

  • Lipidation state analysis: Native LspA is triacylated, whereas recombinant versions may lack modifications. Supplement expression strains with lnt (apolipoprotein N-acyltransferase) to ensure proper maturation .

  • Membrane topology assays: Use protease accessibility studies to confirm correct transmembrane helix orientation .

Table 2: Kinetic Discrepancies and Resolutions in Recombinant LspA

ParameterNative LspA (kcat/Km)Recombinant LspA (kcat/Km)Resolution Method
Substrate affinity4.7 × 10³ M⁻¹s⁻¹2.1 × 10³ M⁻¹s⁻¹Co-expression of lnt
pH optimum7.86.9Buffer ion strength adjustment

What genetic redundancy considerations apply when studying Geobacillus LspA homologs?

Geobacillus genomes often encode multiple lspA paralogs with overlapping functions:

  • CRISPR interference: Knockdown individual paralogs while monitoring lipoprotein processing efficiency.

  • Heterologous complementation: Express each paralog in E. coli ΔlspA to assess functional equivalence. M. xanthus studies showed only partial rescue (≤60% activity) with non-cognate LspA .

  • Transcriptional profiling: RNA-seq under heat stress reveals paralog-specific induction patterns critical for thermoadaptation .

Which signal peptide engineering approaches improve LspA secretion in Gram-positive chassis?

Rational design involves:

  • Library screening: Clone 55–126 nt signal peptides from Bacillus subtilis into LspA expression vectors. Subdivide libraries by length (55–72 nt, 75–96 nt, 102–126 nt) for high-throughput screening .

  • ΔG prediction: Use SignalP 4.0 to rank peptides by secretion efficiency. Optimal signal peptides exhibit ΔG ≤ −3.5 kcal/mol for Sec-translocon recognition .

  • Hybrid peptides: Fuse Geobacillus signal sequences with Bacillus lipobox motifs (e.g., LAGC) to enhance host protease recognition .

Table 3: Signal Peptide Library Performance Metrics

Source OrganismSecretion Efficiency (%)Max Yield (mg/L)Reference
B. subtilis (native)42.3110
G. kaustophilus68.9275
Hybrid (Bsu-Gka)57.1198

How does LspA’s metalloprotease activity influence antibiotic resistance phenotyping?

LspA’s zinc-dependent mechanism confers susceptibility to metal chelators:

  • EDTA inhibition assays: Preincubate LspA with 5 mM EDTA reduces activity by >90%, reversible by Zn²⁺ supplementation .

  • Antibiotic synergy testing: Combine globomycin with Zn²⁺ chelators to enhance efficacy against methicillin-resistant Staphylococcus aureus (MRSA) .

  • Resistance genotyping: Screen clinical isolates for lspA mutations (e.g., H157Y) that reduce metal cofactor binding, as observed in TA-resistant M. xanthus .

Methodological Notes for Contradictory Data

  • Thermostability conflicts: If recombinant LspA shows lower Tm than native, check for missing disulfide bonds via cysteine alkylation assays .

  • Activity loss after IMAC: Imidazole elution buffers ≥200 mM may strip metal ions. Dialyze against Zn²⁺-supplemented buffers immediately post-purification .

  • Inconsistent complementation: Ensure recipient strains lack endogenous lipoproteins (lpp mutants) to avoid competitive inhibition .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.