Recombinant Geobacillus kaustophilus NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; GK3356; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Geobacillus kaustophilus (strain HTA426)
Target Names
nuoA
Target Protein Sequence
MSNIYANSYLIIFVFLCLGVLLPIGALTAGRWLRPHVPSDAKATTYESGNNPFHDSRVQF QVRYYLFALLFVIFDIETVFLYPWAVVYDQLGLFALVEMIIFIVLLAIGLIYAWKKKVLR WM
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, the primary electron acceptor is believed to be a menaquinone. This redox reaction is coupled with proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving energy within a proton gradient.

Database Links

KEGG: gka:GK3356

STRING: 235909.GK3356

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Geobacillus kaustophilus NADH-quinone oxidoreductase subunit A (nuoA) and what is its function?

NADH-quinone oxidoreductase subunit A (nuoA) from Geobacillus kaustophilus is a component of the bacterial respiratory chain, specifically of Complex I (NADH:quinone oxidoreductase). This enzyme catalyzes the electron transfer from NADH to quinones while simultaneously pumping protons across the membrane, contributing to the establishment of a proton gradient used for ATP synthesis. As part of the respiratory chain, nuoA plays a crucial role in energy metabolism in this thermophilic bacterium .

The methodology for studying nuoA function typically involves comparative analysis with similar enzymes from other organisms. For instance, researchers can draw parallels with similar enzymes such as the NADH:quinone oxidoreductase from Methanothermobacter marburgensis (MmNQO), which demonstrates ability to oxidize NADH with several electron acceptors .

What are the structural characteristics of recombinant Geobacillus kaustophilus NADH-quinone oxidoreductase subunit A?

While specific structural data for G. kaustophilus nuoA is limited in the provided search results, we can infer structural characteristics based on related NADH:quinone oxidoreductases. These enzymes typically exhibit a homodimeric flavodoxin-like fold structure where the principal differences are noted in the precise length and conformation of the dimer-interface loops that delineate the flavin-binding pocket .

To determine the structure experimentally, researchers should employ a combination of approaches:

  • Protein crystallography for high-resolution structural determination

  • Comparative modeling using structurally characterized homologs as templates

  • Analysis of conserved domains through bioinformatics approaches

Similar enzymes like MmNQO display a yellow color with spectral properties showing an absorption maximum at 455 nm, suggesting the presence of flavin cofactors such as FAD or FMN that are common prosthetic groups in NADH:quinone oxidoreductases .

How can recombinant Geobacillus kaustophilus NADH-quinone oxidoreductase subunit A be expressed and purified?

The expression and purification of recombinant G. kaustophilus nuoA typically follows established protocols for thermophilic proteins:

  • Expression system selection: E. coli is commonly used as a host organism for heterologous expression of thermophilic proteins. BL21(DE3) or Rosetta strains are particularly suitable.

  • Vector design: Utilize expression vectors containing a His6-tag for affinity purification. This approach has been successful with similar enzymes like MmNQO .

  • Purification method: Immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins is the preferred initial purification step. Purification to homogeneity can be verified by SDS-PAGE, where the apparent molecular weight should correspond to the theoretical weight calculated from the amino acid sequence .

  • Quality control: Assessment of purity through SDS-PAGE and verification of enzymatic activity using standard assays with NADH as the electron donor and various electron acceptors such as DCPIP, coenzyme Q1, or potassium ferricyanide .

When expressing recombinant nuoA, it's important to be aware that any activity detected in the flow-through during IMAC purification might be attributed to endogenous E. coli NADH:quinone oxidoreductases, necessitating careful interpretation of results .

What are the optimal assay conditions for measuring Geobacillus kaustophilus NADH-quinone oxidoreductase activity?

Determination of optimal assay conditions for G. kaustophilus nuoA should be based on systematic variation of parameters while monitoring activity. Based on data from similar enzymes, the following protocol is recommended:

  • Buffer selection: Test various buffers (phosphate, Tris-HCl, HEPES) at pH ranges suitable for thermophilic enzymes (pH 7.0-9.0).

  • Temperature optimization: Given G. kaustophilus is thermophilic, activity assays should be conducted at elevated temperatures (50-80°C), with precise optimization determined experimentally.

  • Substrate concentration: Initial rates should be measured across a range of substrate concentrations to determine Km values. For similar enzymes, Km values for NADH vary from 17 to 258 μM depending on the electron acceptor used .

  • Electron acceptor selection: Test multiple electron acceptors to identify those with optimal activity. The table below shows kinetic parameters for a similar enzyme (MmNQO) with various electron acceptors:

Electron donorElectron acceptorKm (μM)kcat (min⁻¹)kcat/Km (μM⁻¹·min⁻¹)
NADHDCPIP17.54.950.283
NADHCoenzyme Q1033.76.860.204
NADHPotassium ferricyanide74.814.30.191
NADHFc+64.811.20.173
NADH1,4-BQ56.59.740.172
NADHCoenzyme Q196.815.60.161
NADPHCoenzyme Q1111.614.60.130
NADPH1,4-BQ48.16.00.125

This data suggests DCPIP might be an optimal electron acceptor for assaying nuoA activity .

How can researchers distinguish between NADH and NADPH preference in G. kaustophilus NADH-quinone oxidoreductase?

To determine cofactor specificity, researchers should implement a comparative kinetic analysis approach:

  • Parallel assays: Conduct parallel activity measurements using identical concentrations of NADH and NADPH under otherwise identical reaction conditions.

  • Kinetic parameter determination: Calculate the complete kinetic parameters (Km, kcat, and kcat/Km) for both cofactors with multiple electron acceptors.

  • Specificity ratio calculation: Calculate the ratio of kcat/Km values for NADH versus NADPH to quantify preference.

Based on data from similar enzymes like MmNQO, NADH is typically preferred over NADPH as an electron donor. MmNQO shows higher affinity and turnover rates with NADH compared to NADPH, similar to what has been reported for E. coli NDH-1 and Corynebacter glutamicum NADH:quinone oxidoreductase .

Additionally, researchers should test the ability of the enzyme to utilize each cofactor with different electron acceptors, as MmNQO can oxidize NADH with all ten artificial electron acceptor substrates tested, whereas NADPH is only utilized with a subset of acceptors (1,4-BQ, coenzyme Q1, and potassium ferricyanide) .

What methodologies can be used to investigate the cofactor binding in G. kaustophilus NADH-quinone oxidoreductase?

Investigating cofactor binding in nuoA requires multiple complementary approaches:

  • Spectroscopic analysis: Flavin-containing enzymes like NADH:quinone oxidoreductases typically display characteristic absorption spectra with maxima around 450-455 nm. Loss of this signal upon treatment with trichloroacetic acid would suggest the cofactor is tightly bound to the protein .

  • Structural determination: X-ray crystallography in the presence and absence of bound cofactors can provide atomic-level insights into binding modes.

  • Site-directed mutagenesis: Mutation of residues predicted to interact with the cofactor based on homology modeling can confirm their importance. Key residues that might be involved in FMN binding in similar enzymes include Trp, Tyr, Asp, Ser, and Pro residues located near the flavin pocket .

  • Isothermal titration calorimetry (ITC): This technique can provide thermodynamic parameters of cofactor binding, including binding affinity (Kd), enthalpy (ΔH), and stoichiometry.

  • Differential scanning fluorimetry: This method can assess thermal stability differences in the presence and absence of cofactors, providing indirect evidence of binding.

Based on findings from similar enzymes, we would expect G. kaustophilus nuoA to contain either FAD or FMN as a cofactor, with the latter being more common in bacterial NADH:quinone oxidoreductases .

How can researchers use nonexperimental research methods to study G. kaustophilus NADH-quinone oxidoreductase in complex biological systems?

Nonexperimental research approaches are valuable for studying nuoA in complex biological systems, particularly when manipulation of variables is not feasible or ethical . The following methodologies are recommended:

  • Correlational studies: Examine relationships between nuoA expression levels and physiological parameters in G. kaustophilus under various growth conditions.

  • Comparative genomics: Analyze nuoA sequence conservation across Geobacillus species and related thermophilic bacteria to infer functional importance of specific domains.

  • Transcriptomics: Use RNA-Seq to identify co-expressed genes under conditions where nuoA expression is altered, potentially revealing functional networks.

  • Metabolomics: Measure changes in metabolite profiles associated with variations in nuoA activity to understand its broader impact on cellular metabolism.

  • Systems biology modeling: Develop computational models of electron transport chains incorporating nuoA to predict system-level behaviors.

When designing nonexperimental research, researchers should consider that while these approaches cannot establish causality with the same strength as experimental methods, they provide valuable insights into complex biological relationships involving nuoA .

What evolutionary insights can be gained from studying G. kaustophilus NADH-quinone oxidoreductase and how does it compare to similar enzymes?

Evolutionary analysis of G. kaustophilus nuoA can provide significant insights into respiratory chain evolution and adaptation to thermophilic environments:

  • Phylogenetic analysis: Construct phylogenetic trees of nuoA sequences across bacterial lineages to identify evolutionary relationships and potential horizontal gene transfer events.

  • Structural comparison: Compare the predicted structure of G. kaustophilus nuoA with structurally characterized homologs like MmNQO, which shows similarities to three principal classes of NAD(P)H:quinone oxidoreductases: modulator of drug activity B (MdaB), bacterial FMN-dependent azoreductases (AzoR), and mammalian FAD-dependent quinone reductases .

  • Adaptive evolution analysis: Identify sites under positive selection by calculating dN/dS ratios across the nuoA sequence in thermophilic versus mesophilic bacteria.

  • Protein sequence space exploration: Apply nonhomologous random recombination (NRR) techniques to explore sequence variants that maintain or enhance nuoA function, potentially identifying functional regions within the enzyme .

The comparison with similar enzymes reveals that while there are large differences in sequence identity between the three principal groups of NAD(P)H:quinone oxidoreductases (typically 19–23% identity), they all display a structurally well-conserved homodimeric flavodoxin-like fold . This suggests functional convergence despite sequence divergence.

How can recombinant DNA technologies enhance the study and application of G. kaustophilus NADH-quinone oxidoreductase?

Recombinant DNA technologies offer numerous advantages for studying and potentially enhancing nuoA:

  • Expression optimization: Codon optimization for heterologous expression in E. coli can significantly improve protein yield and solubility. Consider using expression vectors with solubility-enhancing fusion partners like MBP (maltose binding protein) .

  • Protein engineering: Site-directed mutagenesis can be employed to:

    • Enhance thermal stability for industrial applications

    • Modify cofactor specificity between NADH and NADPH

    • Alter substrate specificity for different electron acceptors

    • Investigate structure-function relationships

  • Non-homologous random recombination (NRR): This technique enables exploration of sequence space without requiring sequence homology, potentially producing variants with enhanced properties . NRR has been successfully used to evolve nucleic acid aptamers with 15- to 20-fold higher affinity than those evolved using error-prone PCR .

  • Chimeric constructs: Creating fusion proteins or chimeras between nuoA and other functional domains can generate novel activities or improved properties. This approach has been successful with other enzymes like NAGS, where MBP-NAGS chimeras have been used to assess disease-causing variants .

  • In vitro assays with pure recombinant enzyme: These provide more reliable data than using bacterial homologs or in silico prediction servers, particularly for assessing functional impacts of variants .

What are the potential applications of G. kaustophilus NADH-quinone oxidoreductase in biotechnology and bioenergy research?

G. kaustophilus nuoA, as a component of the respiratory chain from a thermophilic organism, offers several promising applications:

  • Biofuel cells: The ability of NADH:quinone oxidoreductases to catalyze electron transfer from NADH to various electron acceptors makes them valuable components in enzyme-based biofuel cells, particularly for high-temperature applications.

  • Bioremediation: NADH:quinone oxidoreductases from related organisms have shown abilities to reduce various compounds, suggesting potential applications in degradation of environmental pollutants at elevated temperatures.

  • Thermostable biosensors: The enzymatic activity can be coupled to detection systems for monitoring NADH levels or electron acceptor reduction in high-temperature industrial processes.

  • Metabolic engineering: Understanding and manipulating respiratory chain components like nuoA can enable engineering of more efficient microbial cell factories for production of chemicals and fuels.

The thermostability of enzymes from G. kaustophilus provides distinct advantages for these applications, allowing processes to operate at elevated temperatures that reduce contamination risk and potentially increase reaction rates.

How should researchers design experiments to compare G. kaustophilus NADH-quinone oxidoreductase with homologous enzymes from other species?

When designing comparative experiments, researchers should implement a systematic approach:

  • Standardized expression and purification: Use identical expression systems, tags, and purification protocols for all enzymes being compared to minimize methodology-induced variations.

  • Parallel characterization:

    • Conduct thermal stability assays across a range of temperatures (25-90°C)

    • Determine pH optima profiles (pH 5-10)

    • Measure kinetic parameters with identical substrate ranges

    • Test identical panels of electron acceptors

  • Structural comparison:

    • Perform comparative modeling using established structures as templates

    • Identify conserved and variable regions

    • Focus on the flavin-binding pocket, where key differences are typically noted

  • Activity normalization: When comparing activities between enzymes, normalize data to account for differences in protein purity and active site concentration.

Structure-based fold similarity analysis using tools like DALI Lite and PDBeFold servers can identify structurally related enzymes, as was done for MmNQO, which identified three principal classes of NAD(P)H:quinone oxidoreductases as structural homologs .

What are the methodological challenges in determining the in vivo role of G. kaustophilus NADH-quinone oxidoreductase and how can they be addressed?

Investigating the in vivo function of nuoA presents several challenges that require specific methodological approaches:

  • Genetic manipulation challenges:

    • Thermophilic organisms like G. kaustophilus often have limited genetic tools

    • Solution: Develop and optimize transformation protocols specific to G. kaustophilus or use heterologous complementation in more genetically tractable model organisms

  • Growth condition requirements:

    • G. kaustophilus requires high-temperature cultivation

    • Solution: Use specialized equipment for high-temperature cultivation and develop protocols for respiratory chain analysis at elevated temperatures

  • Functional redundancy:

    • Many bacteria possess multiple NADH:quinone oxidoreductases with overlapping functions

    • Solution: Create multiple knockout mutants to address redundancy and use specific inhibitors to distinguish between different NADH:quinone oxidoreductases

  • In vivo activity measurement:

    • Measuring enzyme activity in intact cells is challenging

    • Solution: Develop reporter systems linked to nuoA activity or use membrane preparations to measure activity in near-native conditions

  • Protein-protein interactions:

    • Understanding interaction partners is essential for elucidating function

    • Solution: Employ bacterial two-hybrid systems adapted for thermophilic proteins or use crosslinking approaches followed by mass spectrometry

These methodological approaches bridge the gap between in vitro biochemical characterization and in vivo functional understanding, providing a more complete picture of nuoA's role in G. kaustophilus physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.