Recombinant Geobacillus kaustophilus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

The NADH-quinone oxidoreductase subunit K from Geobacillus kaustophilus is encoded by the nuoK gene (ordered locus name: GK3348) in the G. kaustophilus genome. The protein has the UniProt accession number Q5KUK3 and is classified enzymatically with the EC number 1.6.99.5 . It is alternatively known as NADH dehydrogenase I subunit K or NDH-1 subunit K, which reflects its role in the respiratory chain as part of Complex I . This protein belongs to the family of NADH dehydrogenases, which are critical membrane components involved in energy production through the respiratory chain.

Recombinant Expression and Purification

The recombinant G. kaustophilus nuoK protein is typically produced in Escherichia coli expression systems with an N-terminal His-tag to facilitate purification . The expression conditions must be carefully optimized to ensure proper folding and stability of this membrane protein. After expression, the protein is commonly purified using affinity chromatography techniques that leverage the His-tag for selective binding. The purified protein is typically stored in a Tris/PBS-based buffer containing 50% glycerol at pH 8.0, which helps maintain its stability during storage .

Following purification, the protein is often provided in lyophilized powder form with greater than 90% purity as determined by SDS-PAGE analysis . For reconstitution, it is recommended to briefly centrifuge the vial prior to opening and to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added for long-term storage stability .

Physical and Chemical Properties

The recombinant G. kaustophilus nuoK protein demonstrates remarkable thermostability, which is consistent with its origin from a thermophilic organism. G. kaustophilus HTA426 grows optimally at 60°C and can tolerate temperatures ranging from 48 to 74°C . This thermostability makes the recombinant nuoK protein particularly valuable for applications requiring enzymatic activity at elevated temperatures.

Due to its membrane protein nature, nuoK has limited solubility in aqueous solutions and requires detergents or lipid environments for proper folding and stability when studied outside its native membrane context. The protein's thermostability is likely maintained through various structural features, including increased hydrophobic interactions, ionic bonds, and potentially unique amino acid compositions that confer resistance to thermal denaturation .

Role in Complex I of the Respiratory Chain

NADH:quinone oxidoreductase (Complex I) is the largest enzyme in the respiratory chain of both mitochondria and bacteria, where it catalyzes the transfer of electrons from NADH to quinones while simultaneously pumping protons across the membrane . This process is fundamental to cellular energy production. Specifically, nuoK functions as part of the membrane domain of Complex I, which is responsible for proton translocation across the membrane, contributing to the generation of the proton motive force that drives ATP synthesis.

Complex I evolved through the combination of smaller functional building blocks, with nuoK being part of the membrane domain responsible for proton translocation . The membrane domain works in concert with the NADH dehydrogenase module (N-module) and the quinone module (Q-module) to couple electron transfer from NADH to quinone with proton pumping across the membrane .

Conserved Residues and Their Functional Importance

While specific experimental data on G. kaustophilus nuoK is limited in the provided search results, studies on homologous proteins from other organisms provide valuable insights into the functional importance of conserved residues. Research on the Escherichia coli homologue of nuoK (ND4L) has demonstrated that conserved glutamic acid residues, particularly Glu-36 and Glu-72, are critical for the coupling mechanism of NDH-1 .

Mutations of these conserved glutamic acid residues lead to almost null activities of coupled electron transfer with a concomitant loss of generation of the electrochemical gradient . This suggests that these membrane-embedded acidic residues play a crucial role in the proton translocation mechanism of Complex I. The conservation of these residues across species, including G. kaustophilus, underscores their functional importance in the respiratory complex.

Evolutionary Context Within Complex I

The nuoK subunit is part of the membrane domain of Complex I, which has evolved through the combination of smaller functional modules. While the NADH dehydrogenase module (N-module) and quinone module (Q-module) share similarities with soluble enzymes like ferredoxin and NiFe-hydrogenases, the membrane domain containing nuoK appears to have evolved from ancestral ion transporters .

The evolutionary conservation of nuoK across diverse bacterial species highlights its fundamental importance in the function of Complex I. The protein's thermostability in G. kaustophilus can be viewed as an adaptation that allows this respiratory complex to function efficiently in high-temperature environments, representing a specialized evolutionary trajectory within the broader context of respiratory chain evolution.

Biotechnological Potential

The thermostable nature of G. kaustophilus nuoK makes it particularly valuable for biotechnological applications requiring enzymatic activity at elevated temperatures. G. kaustophilus HTA426 is considered a promising chassis for constructing high-temperature resistant cell factories, which offers advantages in preventing contamination by mesophilic bacteria and reducing costs associated with controlling fermentation heat .

Recombinant proteins from thermophilic organisms like G. kaustophilus have potential applications in industrial processes that operate at high temperatures, including biofuel production, bioremediation, and various enzymatic conversions. The stability of these proteins at elevated temperatures can increase process efficiency, reduce cooling requirements, and extend catalyst lifespan.

Research Tool for Complex I Studies

As a component of Complex I, recombinant G. kaustophilus nuoK serves as a valuable research tool for studying the structure, function, and assembly of this essential respiratory complex. The thermostable nature of this protein can facilitate structural studies that might be challenging with mesophilic counterparts due to protein instability.

Studies of thermostable proteins like G. kaustophilus nuoK can provide insights into the molecular basis of protein thermostability, which has fundamental importance in protein engineering and the design of enzymes with enhanced stability for various applications. Furthermore, understanding the function of nuoK in the context of Complex I can contribute to our knowledge of energy metabolism in both prokaryotic and eukaryotic systems.

Technical Challenges in Protein Production

Despite the potential advantages of working with G. kaustophilus nuoK, there are significant technical challenges associated with its production and study. As a membrane protein, nuoK requires specialized expression and purification strategies to ensure proper folding and stability. Conventional expression systems may struggle to produce sufficient quantities of correctly folded membrane proteins, necessitating optimization of expression conditions or the use of specialized expression hosts.

Furthermore, the thermophilic nature of G. kaustophilus presents additional challenges for heterologous expression in mesophilic hosts like E. coli, potentially requiring modifications to expression protocols to accommodate the different folding environments. These technical challenges necessitate careful optimization of production methods to obtain functional recombinant nuoK for research and applications.

Current Research Limitations

Research on G. kaustophilus nuoK specifically has been limited, with most studies focusing on either the general characteristics of G. kaustophilus as a thermophilic organism or on Complex I function across multiple species. The development of improved genetic manipulation tools for G. kaustophilus, as described in recent research , may facilitate more direct studies of nuoK in its native context.

Recent advances in conjugation-based gene transfer methods have provided new approaches for introducing genetic modifications into G. kaustophilus , which could enable more detailed studies of nuoK function through site-directed mutagenesis or gene replacement strategies. These methodological advances hold promise for expanding our understanding of this important respiratory component in thermophilic organisms.

Structure-Function Relationships

Future research efforts should focus on elucidating the detailed structure-function relationships of G. kaustophilus nuoK, particularly its role in proton translocation and the molecular basis of its thermostability. High-resolution structural studies, combined with site-directed mutagenesis of conserved residues, could provide valuable insights into the functional mechanisms of this protein within Complex I.

Comparative studies with homologous proteins from mesophilic organisms could help identify the specific adaptations that confer thermostability to G. kaustophilus nuoK, which could inform protein engineering efforts aimed at enhancing the stability of proteins for various applications. Additionally, reconstitution studies in liposomes or nanodiscs could provide insights into the functional properties of nuoK in a membrane-like environment.

Biotechnological Applications

The development of biotechnological applications leveraging the thermostability of G. kaustophilus nuoK represents another promising direction for future research. This could include the integration of recombinant nuoK into synthetic electron transport chains designed for high-temperature biocatalytic processes or the use of nuoK as a component in biosensors operating under harsh conditions.

Furthermore, understanding the principles of thermostability in G. kaustophilus nuoK could inform broader protein engineering efforts aimed at enhancing the stability of proteins for various industrial applications. The insights gained from studying this thermostable respiratory component could have implications beyond its specific function, contributing to our general understanding of protein stability and function under extreme conditions.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
nuoK; GK3348; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Geobacillus kaustophilus (strain HTA426)
Target Names
nuoK
Target Protein Sequence
MTLSAYLALALILFCIGLYGALTKRNTVIVLICIELMLNAVNINFVAFAKYGAHPSVHGH VFALFAIAVAAAEAAVGLAALIAFYRSRKTVQVDEANSLKH
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this particular species, the immediate electron acceptor for the enzyme is believed to be menaquinone. The enzyme couples the redox reaction to proton translocation (four hydrogen ions translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy within a proton gradient.
Database Links

KEGG: gka:GK3348

STRING: 235909.GK3348

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Geobacillus kaustophilus and why is it significant for biotechnological research?

Geobacillus kaustophilus is a thermophilic Gram-positive bacterium that has gained significant attention as an attractive host for the development of high-temperature bioprocesses . This organism offers several advantages for biotechnological applications, including thermostability of its enzymes and cellular components, which enables industrial processes at elevated temperatures.

The bacterium's thermophilic nature (optimal growth at 60°C) makes it particularly valuable for studying enzyme function under extreme conditions. While G. kaustophilus has been historically challenging to manipulate genetically, recent methodological advances have improved transformation efficiency . These developments include pLS20-mediated conjugation transfer from Bacillus subtilis, which enables the integration of artificial DNA segments into the G. kaustophilus genome .

The complete genome sequence of G. kaustophilus HTA426, isolated from the Mariana Trench, has been determined, revealing significant adaptations to extreme environments that make it an excellent model organism for studying thermophilic adaptations in respiratory enzymes like NADH-quinone oxidoreductase .

What methodological approaches are most effective for genetic manipulation of Geobacillus kaustophilus?

The genetic manipulation of G. kaustophilus has historically been challenging due to its recalcitrance to standard transformation methods. Researchers have developed the following methodological approaches:

  • pLS20-mediated conjugation strategy: This technique involves the design of an artificial DNA segment on the chromosome of Bacillus subtilis that can be transferred via pLS20-mediated conjugation, resulting in subsequent integration into the G. kaustophilus genome .

  • Homologous recombination approaches: These methods utilize the natural competence machinery and homologous recombination capabilities to integrate foreign DNA .

  • Expression vector systems: Several shuttle vectors have been developed that can replicate in both E. coli and Geobacillus species.

Genetic Manipulation MethodKey FeaturesEfficiencyReference
pLS20-mediated conjugationTransfer of artificial DNA segment from B. subtilisHigh for large constructs
Homologous recombinationNatural integration into target genomic lociModerate, depends on homology length
ElectroporationDirect DNA introductionLower efficiency, requires specialized buffers-

This methodology can be adapted to various Gram-positive bacteria beyond G. kaustophilus, taking advantage of the plasticity of the B. subtilis genome and the simplicity of pLS20 conjugation transfer .

What is the role of NADH-quinone oxidoreductase in bacterial energy metabolism?

NADH-quinone oxidoreductase (NDH-1 in bacteria, Complex I in mitochondria) is a central enzyme in cellular respiration that couples electron transfer from NADH to quinone with proton translocation across the membrane, contributing to the proton motive force used for ATP synthesis. In thermophilic bacteria like G. kaustophilus, this complex must maintain functionality at elevated temperatures.

The bacterial NDH-1 typically consists of 14 subunits (NuoA-N), with NuoK representing one of the membrane domain subunits homologous to mitochondrial ND4L . This complex performs two critical functions:

  • Electron transfer from NADH to quinone, catalyzing the reaction:
    NADH + H⁺ + Q → NAD⁺ + QH₂

  • Proton translocation across the membrane, contributing to the electrochemical gradient that drives ATP synthesis.

The coupled electron transfer and proton translocation activities are essential for energy conservation in bacterial cells, making the complex a crucial component of cellular bioenergetics.

What is the structural and functional significance of NuoK subunit in the NADH-quinone oxidoreductase complex?

The NuoK subunit (homologous to mitochondrial ND4L) is one of the smallest but functionally critical components of the membrane domain of NADH-quinone oxidoreductase . Despite its small size, NuoK plays crucial roles in:

Studies of the E. coli homologue of NuoK have revealed that mutations of conserved glutamic acid residues (particularly Glu-36 and Glu-72) located in the membrane region severely impair the coupled electron transfer activity . These membrane-embedded acidic residues appear to be crucial for the coupling mechanism of NDH-1 .

Additionally, vicinal arginine residues on a cytosolic loop of NuoK have been shown to be important for function, as simultaneous mutation of these residues results in significant impairment of coupled activities .

Conserved ResidueLocationEffect of MutationFunctional Significance
Glu-36Membrane-embeddedNear-complete loss of coupled activityCritical for proton translocation
Glu-72Membrane-embeddedSignificant diminution of coupled activitiesImportant for coupling mechanism
Arginine pairCytosolic loopSevere impairment when simultaneously mutatedPossibly involved in conformational changes

What expression systems are most appropriate for recombinant Geobacillus kaustophilus NuoK?

When designing expression systems for recombinant G. kaustophilus NuoK, researchers should consider the following methodological approaches:

  • Heterologous expression in E. coli: The most common approach involves cloning the nuoK gene into vectors like pET-28a for expression in E. coli BL21(DE3) or similar strains . This system offers:

    • Well-established protocols

    • High expression levels

    • Simplified purification via affinity tags

    • Challenges with proper membrane protein folding

  • Homologous expression in Geobacillus: Expression within Geobacillus species provides native-like conditions but requires:

    • Development of specialized vectors

    • Optimization of transformation protocols

    • Growth at elevated temperatures (55-65°C)

    • Limited availability of selection markers

  • Cell-free expression systems: These can be advantageous for membrane proteins like NuoK:

    • Direct access to reaction conditions

    • Avoidance of toxicity issues

    • Simplified incorporation of isotopic labels

    • Higher cost compared to in vivo systems

Expression SystemAdvantagesDisadvantagesOptimal Conditions
E. coli (pET system)High yield, well-establishedPotential folding issuesInduction at low temperature (16-25°C), membrane-mimetic additives
Geobacillus homologousNative-like folding, thermostabilityLower yields, technical challengesGrowth at 55-65°C, specialized media
Cell-free systemDirect condition control, no toxicityHigher cost, lower scaleTemperature cycling, chaperone supplementation

The methodology described for cloning and expressing G. kaustophilus enzymes, such as the approach used for the putative ribonucleotide reductase small subunit GkR2loxI (GK2771), can be adapted for nuoK studies . This involves PCR amplification of the open reading frame, cloning into expression vectors like pET-28a, and heterologous protein production in E. coli .

What purification strategies are most effective for thermophilic membrane proteins like NuoK?

Purification of recombinant thermophilic membrane proteins such as G. kaustophilus NuoK presents unique challenges requiring specialized methodological approaches:

  • Membrane extraction optimization:

    • Detergent screening is critical (DDM, LMNG, and SMA polymers are often effective)

    • Heat treatment (45-50°C) can be employed to precipitate E. coli proteins while retaining thermostable targets

    • Gradual solubilization approaches may improve native folding retention

  • Chromatographic purification:

    • Immobilized metal affinity chromatography (IMAC) with N- or C-terminal His-tags

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • Ion exchange chromatography as a polishing step

  • Stability enhancement during purification:

    • Addition of lipids or nanodiscs to maintain native-like environment

    • Buffer optimization with glycerol (10-20%) and salt (300-500 mM)

    • Temperature control during purification steps

The thermophilic nature of G. kaustophilus proteins can be leveraged during purification, as demonstrated in the study of other G. kaustophilus enzymes like GkR2loxI . Heat treatment steps can selectively denature contaminating proteins from mesophilic expression hosts while preserving the thermostable target protein.

Purification StepKey ParametersCritical Considerations
Membrane isolationLow-speed centrifugation (5,000×g) followed by ultracentrifugation (100,000×g)Buffer pH, protease inhibitors
Detergent solubilization1-2% detergent, 1-4 hours, 4°C or room temperatureDetergent:protein ratio, solubilization efficiency
IMAC purification20-250 mM imidazole gradientDetergent in all buffers, column temperature
Size exclusionFlow rate <0.5 mL/minColumn equilibration with detergent

How should researchers approach contradictory data when studying recombinant NuoK function?

When confronted with data that contradicts the expected function or properties of recombinant G. kaustophilus NuoK, researchers should implement the following methodological framework:

  • Thorough examination of the experimental data:

    • Identify specific discrepancies between expected and observed results

    • Pay particular attention to outliers that may indicate experimental artifacts or novel phenomena

    • Compare findings with existing literature on related proteins (e.g., E. coli NuoK)

  • Evaluation of experimental design and assumptions:

    • Reassess the initial hypothesis and underlying assumptions

    • Consider whether expression system choice impacts protein functionality

    • Evaluate whether detergents or purification methods affect protein activity

  • Alternative explanations exploration:

    • Consider species-specific adaptations in thermophiles

    • Evaluate potential post-translational modifications

    • Examine if experimental conditions (temperature, pH, salt) match physiological context

  • Methodological refinements:

    • Modify protein production and purification protocols

    • Implement additional controls specific to membrane proteins

    • Consider comparative analysis with homologous proteins

When addressing contradictory data, it's essential to maintain an open scientific mindset, as unexpected findings can lead to new discoveries, similar to how researchers identified that the putative ribonucleotide reductase small subunit (GkR2loxI) in G. kaustophilus actually functions as a novel alkane monooxygenase .

Data Contradiction TypeInvestigation ApproachPotential Resolution
Activity discrepanciesMultiple activity assays, varied conditionsIdentification of optimal assay conditions or cofactors
Structural inconsistenciesAlternative structural techniques (CD, DSC, limited proteolysis)Revelation of condition-dependent conformational states
Expression problemsExpression system variations, fusion partnersDetermination of optimal expression parameters

What site-directed mutagenesis approaches are most informative for functional studies of NuoK?

Site-directed mutagenesis represents a powerful approach for elucidating structure-function relationships in NuoK. Based on studies of homologous proteins, the following methodological framework is recommended:

  • Target selection strategy:

    • Focus on highly conserved residues across species, particularly:

      • Membrane-embedded glutamic acids (homologous to E. coli Glu-36 and Glu-72)

      • Charged residues (arginine, lysine) on cytosolic loops

      • Residues at predicted quinone-binding sites

    • Consider both conservative and non-conservative substitutions

  • Mutagenesis methodology:

    • PCR-based site-directed mutagenesis using the nuoK gene cloned in an appropriate vector

    • QuikChange or Q5 site-directed mutagenesis protocols

    • Gibson Assembly for multiple mutations or difficult templates

  • Functional assessment approach:

    • Assay for electron transfer activity (NADH:quinone oxidoreductase)

    • Measure proton translocation using reconstituted proteoliposomes

    • Assess complex assembly via blue-native gel electrophoresis and immunostaining

Studies of the E. coli NuoK homolog demonstrated that mutations of highly conserved Glu-36 resulted in nearly complete loss of coupled electron transfer activity and proton translocation, while Glu-72 mutations caused significant diminution of coupled activities . Similarly, simultaneous mutation of two vicinal arginine residues on a cytosolic loop severely impaired coupled activities .

Residue TypeSuggested MutationsExpected Functional ImpactAnalytical Approach
Conserved acidic (Glu)E→Q (conservative), E→A (non-conservative)Disruption of proton pathwayNADH oxidation, proton translocation
Conserved basic (Arg)R→K (conservative), R→A (non-conservative)Altered conformational dynamicsAssembly analysis, electron transfer
Conserved hydrophobicL→A, L→F, L→WStructural perturbationThermal stability, assembly analysis

What techniques provide the most informative structural data for thermophilic membrane proteins like NuoK?

Structural characterization of thermophilic membrane proteins like G. kaustophilus NuoK requires specialized methodological approaches:

  • X-ray crystallography optimization:

    • Lipidic cubic phase (LCP) crystallization

    • Surface entropy reduction mutations

    • Antibody fragment co-crystallization to increase polar surface area

    • Thermostability assays to identify optimal detergent and buffer conditions

  • Cryo-electron microscopy approaches:

    • Single-particle analysis of the entire NDH-1 complex

    • Focus on membrane domain subcomplex containing NuoK

    • Utilize latest direct electron detectors and image processing algorithms

    • Consider nanodiscs or amphipols to maintain native-like environment

  • Complementary biophysical techniques:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Electron paramagnetic resonance (EPR) spectroscopy for conformational dynamics

    • Small-angle X-ray scattering (SAXS) for solution structure

    • Molecular dynamics simulations with specific focus on thermostability features

The crystal structure of related G. kaustophilus proteins, such as GkR2loxI (PDB: 4HR0_A), provides valuable methodological insights for structural studies of thermophilic membrane proteins . This structure revealed important features about metal-binding sites and substrate interactions that could inform structural studies of NuoK.

Structural TechniqueAdvantages for NuoKLimitationsResolution Range
X-ray crystallographyAtomic resolution, cofactor visualizationCrystallization challenges1.5-3.5 Å
Cryo-EMVisualization in complex, fewer crystals neededLower resolution for small proteins2.5-4 Å
HDX-MSDynamics information, less sample requiredIndirect structural informationPeptide-level
Computational modelingTemplate-based modeling from homologsAccuracy depends on template qualityN/A

How does G. kaustophilus NuoK compare to homologous proteins from other bacteria, and what insights can be gained from comparative analysis?

Comparative analysis between G. kaustophilus NuoK and homologous proteins from other bacteria can provide valuable insights into thermoadaptation and functional conservation:

  • Sequence comparison methodology:

    • Multiple sequence alignment of NuoK/ND4L from diverse species

    • Phylogenetic analysis to identify lineage-specific adaptations

    • Calculation of conservation scores for each position

    • Focus on thermophilic vs. mesophilic variations

  • Structural comparison approach:

    • Homology modeling of G. kaustophilus NuoK based on existing structures

    • Superposition with E. coli and other bacterial homologs

    • Analysis of electrostatic surface properties

    • Identification of thermostability-enhancing features:

      • Increased internal hydrophobic packing

      • Additional salt bridges and hydrogen bonds

      • Reduced surface loop flexibility

  • Functional comparison framework:

    • Activity assays across temperature ranges (30-80°C)

    • Thermal stability measurements (Tm determination)

    • pH and salt concentration optima comparison

Studies on other G. kaustophilus enzymes have revealed that proteins from this thermophile often contain adaptations that enhance protein stability at elevated temperatures. For example, the discovery that GkR2loxI functions as a novel alkane monooxygenase demonstrates how thermophilic proteins can evolve specialized functions that differ from their mesophilic counterparts .

Bacterial SourceGrowth TemperatureKey NuoK FeaturesFunctional Implications
G. kaustophilus55-65°CEnhanced hydrophobic core, additional salt bridgesThermostability, potential altered substrate specificity
E. coli37°CConserved glutamic acids (Glu-36, Glu-72)Well-characterized proton translocation pathway
T. thermophilus65-70°CSimilar thermostable adaptationsModel for other thermophilic respiratory complexes

What are promising research directions for G. kaustophilus NuoK that could advance our understanding of respiratory complexes?

Future research on G. kaustophilus NuoK presents several promising directions that could enhance our understanding of respiratory complexes:

  • Thermoadaptation mechanisms investigation:

    • Systematic mutagenesis of thermophilic-specific residues to mesophilic counterparts

    • Characterization of temperature-dependent conformational changes

    • Comparison of kinetic parameters across temperature ranges

  • Proton translocation pathway elucidation:

    • Identification of water molecules within the membrane domain

    • Electrophysiological studies of reconstituted NuoK

    • Time-resolved spectroscopy to capture conformational dynamics

  • Integration with synthetic biology applications:

    • Development of thermostable respiratory complexes for biofuel cells

    • Engineering chimeric complexes with enhanced stability

    • Creation of minimal functional units for biotechnological applications

The recent advancement in genetic manipulation tools for G. kaustophilus, including pLS20-mediated conjugation methods, provides new opportunities to conduct in vivo studies of nuoK function and regulation . Additionally, the methodology used to characterize the novel alkane monooxygenase activity of GkR2loxI could be adapted to explore potential moonlighting functions of NuoK in thermophiles .

Research DirectionMethodological ApproachPotential Impact
Thermoadaptation mechanismsComparative structural biology, mutagenesisEngineering thermostable respiratory enzymes
Proton translocationReconstitution studies, spectroscopyUnderstanding fundamental bioenergetic mechanisms
Synthetic applicationsChimeric constructs, directed evolutionDevelopment of thermostable biocatalysts

How can contradictory experimental results be leveraged to drive new discoveries in NuoK research?

Contradictory experimental results, rather than being obstacles, can be systematically leveraged to drive new discoveries in NuoK research:

  • Methodological framework for investigating discrepancies:

    • Document all unexpected results in detail, including exact conditions

    • Design experiments specifically to challenge current hypotheses

    • Implement factorial experimental designs to identify interacting variables

    • Consider that contradictions may reveal novel functions or regulatory mechanisms

  • Data analysis strategies:

    • Apply statistical methods to quantify the significance of discrepancies

    • Use bioinformatics to identify unusual sequence or structural features

    • Conduct literature meta-analysis to identify similar contradictions in related proteins

  • Collaborative investigation approaches:

    • Engage researchers using complementary techniques

    • Establish standardized protocols for cross-laboratory validation

    • Share raw data to enable reanalysis with alternative methods

The discovery of the novel function of GkR2loxI illustrates how "accidental" findings can lead to significant scientific breakthroughs . Similarly, researchers discovered an unexpected alkane degradation capability in G. kaustophilus HTA426 despite the absence of known alkane oxygenating enzyme genes, leading to the identification of GkR2loxI as a novel heterodinuclear Mn-Fe alkane monooxygenase/hydroxylase .

Type of ContradictionInvestigation StrategyPotential Discovery
Unexpected activitySubstrate screening, proteomicsNovel enzymatic function
Unusual stability profileStructural analysis at temperature extremesNew thermostability mechanism
Genetic knockout effectsGlobal transcriptomic analysisRegulatory network insights

This approach to contradictory data aligns with the scientific principle that unexpected results often drive paradigm shifts in understanding. By systematically investigating discrepancies rather than dismissing them, researchers can potentially uncover novel aspects of NuoK function that advance the field of bioenergetics and thermophilic adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.