Recombinant Geobacillus kaustophilus Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Geobacillus kaustophilus Protein CrcB homolog 1 (CrcB1) is a protein derived from the bacterium Geobacillus kaustophilus. CrcB1 is a putative fluoride ion transporter and a member of the CrcB family of proteins . Homologs of CrcB are found in various bacterial species and are associated with fluoride resistance .

Protein Characteristics

The crcB1 gene encodes a protein consisting of 116 to 124 amino acids . The E. coli CrcB protein shares approximately 51% amino acid sequence similarity with the Geobacillus kaustophilus CrcB1 protein . Recombinant CrcB1 protein is often produced in E. coli with an N-terminal His tag to facilitate purification .

Table 1: Key Features of Recombinant Geobacillus kaustophilus Protein CrcB homolog 1 (CrcB1)

FeatureDescription
SpeciesGeobacillus kaustophilus
SynonymscrcB1, GK2702, Putative fluoride ion transporter CrcB 1
UniProt IDQ5KWE9
Protein LengthFull Length (1-116 aa)
TagHis tag
SourceE. coli
FormLyophilized powder
Amino Acid SequenceMYAPLFVAIGGFFGAMARYLVSRWAARRSPRFPLGTLIVNLLGSFLLGWLAGSGAADAAKLLVGTGFMGAFTTFSTLKWESVQMMQQRQWAKVVVYLAATYLCGVWLAWLGYHVGR
PurityGreater than 90% as determined by SDS-PAGE

Production and Handling

Recombinant CrcB1 protein is produced in E. coli and purified. The protein is supplied as a lyophilized powder and should be stored at -20°C to -80°C upon receipt . It is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and to add glycerol (5-50% final concentration) for long-term storage . Repeated freezing and thawing should be avoided, and working aliquots should be stored at 4°C for up to one week .

Function and Significance

CrcB proteins are involved in fluoride resistance in various bacteria . Fluoride, while beneficial in low concentrations (e.g., in toothpaste), can be toxic to bacteria at higher concentrations . CrcB1, as a putative fluoride ion transporter, likely plays a role in maintaining fluoride homeostasis in Geobacillus kaustophilus .

Homologs and Related Proteins

CrcB1 has homologs in other bacterial species, including E. coli. These homologs often share significant amino acid sequence similarity and are involved in similar functions related to fluoride resistance . For example, Streptococcus species utilize EriC1 or CrcB proteins for fluoride resistance .

Potential Applications

Recombinant CrcB1 protein can be utilized in various research applications, including:

  • Biochemical Assays: Studying the protein's function as a fluoride ion transporter and its biochemical properties.

  • Structural Studies: Determining the 3D structure of the protein to understand its mechanism of action.

  • Antibacterial Research: Investigating its role in bacterial fluoride resistance and developing potential antibacterial strategies.

Research Findings

  • CREB1 and Viral Replication: cAMP-responsive element-binding protein (CREB1) interacts directly with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) helicase non-structural protein 13 (nsp13) and potentiates its ATPase and helicase activity . Inhibition of CREB1 dramatically impairs SARS-CoV-2 replication in vivo .

  • Bacteriocins in Carnobacterium maltaromaticum: Carnobacterium maltaromaticum strains with potent anti-Listeria monocytogenes activity are characterized by high potency and a wide intraspecific spectrum . Genome mining revealed the presence of 12 bacteriocin biosynthetic gene clusters (BGCs), including newly described bacteriocins and nonribosomal peptide synthetase and polyketide synthase (NRPS-PKS) BGCs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
crcB1; GK2702; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Geobacillus kaustophilus (strain HTA426)
Target Names
crcB1
Target Protein Sequence
MYAPLFVAIGGFFGAMARYLVSRWAARRSPRFPLGTLIVNLLGSFLLGWLAGSGAADAAK LLVGTGFMGAFTTFSTLKWESVQMMQQRQWAKVVVYLAATYLCGVWLAWLGYHVGR
Uniprot No.

Target Background

Function

Important Function: Reduces intracellular fluoride concentration, mitigating its toxicity.

Database Links

KEGG: gka:GK2702

STRING: 235909.GK2702

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and sequence of Geobacillus kaustophilus CrcB homolog 1 protein?

Geobacillus kaustophilus CrcB homolog 1 (crcB1) is a protein identified in the thermophilic bacterium Geobacillus kaustophilus strain HTA426. The full amino acid sequence is: MYAPLFVAIGGFFGAMARYLVSRWAARRSPRFPLGTLIVNLLGSFLLGWLAGSGAADAAKLLVGTGFMGAFTTFSTLKWESVQMMQQRQWAKVVVYLAATYLCGVWLAWLGYHVGR. This protein is referenced in UniProt database with accession number Q5KWE9 and has an expression region spanning positions 1-116. The protein is encoded by the crcB1 gene, with ordered locus name GK2702 in the bacterial genome .

What is the general function of CrcB proteins in bacteria, and is this function conserved in thermophilic bacteria?

CrcB proteins generally function as fluoride ion channels or transporters in bacteria, providing protection against fluoride toxicity by exporting fluoride ions from the cell. In thermophilic bacteria like G. kaustophilus, these proteins must maintain their structural integrity and function at elevated temperatures. Research suggests that while the primary function may be conserved, thermophilic variants like crcB1 likely possess structural adaptations that contribute to thermostability. Experimental approaches to confirm this typically include comparing sequence homology with mesophilic CrcB proteins and conducting ion transport assays at various temperatures to assess functional conservation .

What are the optimal storage and handling conditions for recombinant crcB1 protein to maintain stability?

For optimal storage and handling of recombinant crcB1 protein from G. kaustophilus, researchers should maintain the protein in Tris-based buffer with 50% glycerol, optimized specifically for this protein. Long-term storage should be at -20°C or -80°C for extended preservation. Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity. For working aliquots, storage at 4°C is suitable for up to one week. When conducting experiments, it's advisable to confirm protein stability using techniques such as circular dichroism or differential scanning fluorimetry, particularly when exposing the protein to different temperature conditions given its thermophilic origin .

What expression systems are most effective for producing functional recombinant G. kaustophilus crcB1?

When selecting expression systems for G. kaustophilus crcB1, researchers should consider both the thermophilic origin of the protein and its membrane-associated nature. E. coli BL21(DE3) with modifications for expressing membrane proteins has proven effective for thermophilic proteins. Alternative systems include Geobacillus species themselves, which provide a native-like environment for proper folding. For expression vectors, those containing T7 promoters with thermostable selection markers can be particularly useful. Expression protocols typically involve induction at elevated temperatures (37-45°C) to facilitate proper folding. Purification may require specialized detergents to solubilize the membrane-associated protein, followed by affinity chromatography using tags determined during the production process .

How can researchers effectively study the role of crcB1 in fluoride resistance mechanisms in thermophilic environments?

To study crcB1's role in fluoride resistance in thermophilic environments, researchers should employ a multi-faceted approach. First, generate knockout mutants using CRISPR/Cas9 systems adapted for thermophiles, followed by complementation studies. Fluoride sensitivity assays should be conducted at elevated temperatures (50-70°C) using various concentrations (0.1-50 mM NaF) with growth monitored via optical density measurements. For mechanistic insights, employ fluoride-selective electrodes to measure intracellular vs. extracellular fluoride concentrations in wild-type vs. mutant strains. Additionally, structure-function analysis using site-directed mutagenesis of conserved residues can identify critical amino acids for transport function. Protein localization studies using fluorescent tags or immunogold labeling with transmission electron microscopy can confirm membrane integration. These approaches should be conducted in parallel with controls at various temperatures to distinguish thermophile-specific adaptations .

What methodologies are recommended for investigating potential interactions between crcB1 and insertion sequences in G. kaustophilus?

For investigating interactions between crcB1 and insertion sequences (IS) in G. kaustophilus, researchers should implement a comprehensive approach combining genomic, transcriptomic, and functional analyses. Begin with comparative genomic analysis using tools like ISsaga to identify IS elements proximal to the crcB1 gene across multiple G. kaustophilus strains. RNA-seq analysis under varying conditions (different temperatures, fluoride concentrations) can reveal co-regulation patterns between crcB1 and nearby IS elements. To assess functional impacts, construct reporter gene fusions with the crcB1 promoter and monitor expression changes when specific IS elements are present or absent. ChIP-seq analysis using antibodies against IS-encoded transposases can identify direct interactions with the crcB1 locus. Southern blot analysis under growth-inhibitory conditions should be performed to detect IS transposition events that may affect crcB1 expression. These experiments should be conducted at both optimal (60-65°C) and stress temperatures to capture temperature-dependent transposition dynamics .

What computational approaches are most effective for predicting the membrane topology of G. kaustophilus crcB1?

For predicting membrane topology of G. kaustophilus crcB1, researchers should employ multiple complementary computational approaches. Begin with transmembrane prediction tools including TMHMM, HMMTOP, and Phobius, which utilize different algorithms to identify membrane-spanning regions. The consensus from these tools provides greater confidence in predictions. For thermophilic proteins specifically, incorporate Thermostability Index calculations to identify regions likely to maintain stability at elevated temperatures. Homology modeling using crystallized CrcB proteins (such as those from E. coli or F. nucleatum) as templates can provide structural insights, though modifications to account for thermostability should be incorporated. Molecular dynamics simulations at elevated temperatures (60-70°C) can further refine models by revealing temperature-dependent conformational changes. These computational predictions should be validated experimentally using techniques such as cysteine scanning mutagenesis coupled with accessibility assays to confirm membrane-spanning regions .

How can researchers experimentally validate the predicted membrane topology of crcB1?

To experimentally validate crcB1 membrane topology, researchers should implement a multi-technique approach. Begin with cysteine scanning mutagenesis, systematically replacing predicted internal and external residues with cysteine. Apply membrane-impermeable sulfhydryl reagents to identify exposed cysteines, indicating extracellular regions. Complement this with PhoA/LacZ fusion analysis, where PhoA is only active when translocated to the periplasm while LacZ functions in the cytoplasm. Engineer a series of truncated crcB1-PhoA/LacZ fusions and measure respective enzyme activities to map topology. For thermophilic proteins specifically, these assays should be performed at both standard (37°C) and elevated temperatures (60°C) using thermostable variants of reporter enzymes. Additionally, protease protection assays using right-side-out and inside-out membrane vesicles can identify protected versus exposed regions. Finally, cryo-electron microscopy represents the gold standard for definitive structural determination, though technical challenges exist for small membrane proteins like crcB1 .

What techniques are most appropriate for quantifying the thermostability of recombinant crcB1 protein?

To quantify crcB1 thermostability, researchers should employ multiple biophysical techniques. Differential scanning calorimetry (DSC) provides direct measurement of thermal denaturation by monitoring heat capacity changes during temperature ramping (25-100°C), yielding melting temperature (Tm) values. Circular dichroism (CD) spectroscopy at far-UV wavelengths (190-260 nm) tracks secondary structure changes during thermal denaturation, offering complementary Tm data. For membrane proteins like crcB1, reconstitution into liposomes or nanodiscs prior to these analyses often provides more native-like stability profiles. Functional thermostability can be assessed through fluoride transport assays in proteoliposomes at increasing temperatures, measuring the temperature at which 50% activity is lost (T50). Differential scanning fluorimetry using thermally stable fluorophores (such as SYPRO Orange variants with high Tm) can provide high-throughput screening of buffer conditions that maximize stability. A comparative analysis with mesophilic CrcB homologs should be performed to quantify the thermostability advantage of the G. kaustophilus variant .

How can researchers identify the specific amino acid residues contributing to the thermostability of G. kaustophilus crcB1?

To identify thermostability-contributing residues in G. kaustophilus crcB1, researchers should implement a systematic approach combining computational and experimental methods. Begin with sequence alignment of crcB1 against mesophilic homologs to identify unique substitutions in the thermophilic variant. Computational analyses including relative amino acid frequency calculation, charged versus uncharged residue distribution, and prediction of ion pairs can highlight potential thermostabilizing features. B-factor analysis from molecular dynamics simulations at elevated temperatures can identify regions of high flexibility that might benefit from stabilizing mutations. Experimentally, conduct alanine scanning mutagenesis of candidate residues followed by thermal stability assays. Hydrogen-deuterium exchange mass spectrometry at different temperatures can identify regions with temperature-dependent conformational stability. More sophisticated approaches include ancestral sequence reconstruction to identify evolutionary adaptations toward thermostability. Create chimeric proteins between thermophilic and mesophilic CrcB proteins, systematically replacing domains to identify regions conferring thermostability. Validate findings with site-directed mutagenesis of mesophilic CrcB proteins to introduce thermostabilizing features identified from G. kaustophilus crcB1 .

What methodologies are recommended for studying the expression patterns of the crcB1 gene in G. kaustophilus under various environmental conditions?

To study crcB1 expression patterns in G. kaustophilus under various environmental conditions, researchers should employ a comprehensive set of molecular techniques. Real-time quantitative PCR (RT-qPCR) with primers specifically targeting the crcB1 transcript provides the foundation for expression analysis, with 16S rRNA or DNA gyrase subunit B (gyrB) serving as appropriate reference genes for thermophiles. RNA-seq analysis offers genome-wide context for crcB1 expression patterns relative to other genes. For direct visualization, construct transcriptional fusions between the crcB1 promoter and reporter genes such as thermostable variants of GFP or luciferase. Environmental conditions to test should include temperature gradients (45-80°C), varying fluoride concentrations (0-50 mM), pH variations (5-9), and growth phases (early exponential to stationary). Additionally, examine expression under conditions known to activate stress responses, as transposition activity correlates with sigX-dependent stress responses in G. kaustophilus. Northern blot analysis can confirm transcript size and stability, while primer extension or 5' RACE can precisely map transcription start sites under different conditions .

How might insertion sequences (IS) influence the expression and function of crcB1 in G. kaustophilus, and what experimental approaches can test these hypotheses?

Insertion sequences (IS) could influence crcB1 expression and function in G. kaustophilus through multiple mechanisms: promoter disruption, introduction of new regulatory elements, or creation of fusion proteins. To investigate these effects, researchers should first conduct whole-genome sequencing of multiple G. kaustophilus isolates to identify natural IS insertion events near the crcB1 locus. For controlled studies, employ transposon mutagenesis using characterized IS elements from G. kaustophilus, followed by screening for altered fluoride resistance phenotypes. Construct reporter gene fusions with the crcB1 promoter and monitor expression changes when specific IS elements are inserted at various positions. RNA-seq analysis comparing wild-type strains to those with IS insertions can reveal global transcriptional effects. CRISPR interference (CRISPRi) targeting specific IS elements can temporarily repress their activity to assess reversible effects on crcB1 expression. Importantly, conduct these experiments under stress conditions known to activate IS transposition in G. kaustophilus, particularly at elevated temperatures where transposition is more active. To determine if crcB1 expression changes correlate with IS transposition events during stress responses, perform simultaneous tracking of IS mobility (via Southern blotting) and crcB1 expression (via RT-qPCR) under identical conditions .

What role might G. kaustophilus crcB1 play in CRISPR-based genome editing systems for thermophilic organisms?

G. kaustophilus crcB1 may have significant applications in CRISPR-based genome editing systems for thermophilic organisms, particularly as a selectable marker or in temperature-responsive regulatory systems. Researchers can develop CRISPR-Cas9 systems where crcB1 functions as a selection marker in fluoride-containing media, where only successfully edited cells expressing crcB1 would survive. To implement this approach, construct vectors containing both Cas9/sgRNA components and crcB1 under control of a thermostable promoter. The thermostability of crcB1 makes it particularly valuable for editing other thermophiles where conventional markers may be non-functional at elevated temperatures. Additionally, the crcB1 promoter could be harnessed as a thermoinducible element for controlling Cas9 expression at specific temperatures, providing temporal control of genome editing. For validation, compare editing efficiency using crcB1-based selection versus traditional methods across a temperature range of 45-70°C in various thermophilic bacteria. When implementing such systems, researchers should carefully characterize the fluoride concentration threshold that provides effective selection without inhibiting cellular processes necessary for successful genome editing .

How can researchers effectively study potential interactions between crcB1 and other membrane proteins in G. kaustophilus?

To study interactions between crcB1 and other membrane proteins in G. kaustophilus, researchers should implement multiple complementary approaches optimized for thermophilic membrane proteins. Begin with in vivo techniques such as bacterial two-hybrid systems adapted for high temperature growth, using thermostable reporter proteins. Split-protein complementation assays using fragments of thermostable fluorescent proteins fused to crcB1 and candidate interacting partners can visualize interactions within living cells. For biochemical validation, employ co-immunoprecipitation using antibodies against crcB1 or epitope tags, followed by mass spectrometry to identify interacting partners. Crosslinking mass spectrometry using thermostable crosslinkers can capture transient interactions. For detailed biophysical characterization, fluorescence resonance energy transfer (FRET) between labeled proteins can quantify interaction strength at different temperatures. Reconstitution studies in proteoliposomes containing purified crcB1 and candidate partners, followed by functional assays, can establish the physiological relevance of interactions. When conducting these experiments, incorporate appropriate controls for non-specific interactions and perform assays at both standard and elevated temperatures (45-70°C) to identify temperature-dependent interaction dynamics .

What computational approaches should researchers use to identify and compare crcB homologs across thermophilic bacterial species?

For identifying and comparing crcB homologs across thermophilic bacteria, researchers should implement a multi-tiered computational approach. Begin with position-specific iterative BLAST (PSI-BLAST) searches using G. kaustophilus crcB1 as the query sequence against thermophilic bacterial genome databases. Hidden Markov Model (HMM) profiles built from confirmed crcB sequences increase sensitivity for detecting distant homologs. For comparative analysis, construct multiple sequence alignments using MUSCLE or MAFFT algorithms with parameters optimized for membrane proteins. Calculate sequence conservation scores for each position to identify functionally critical residues. Phylogenetic tree construction using maximum likelihood methods (RAxML or IQ-TREE) with appropriate substitution models can reveal evolutionary relationships between thermophilic and mesophilic crcB variants. Ancestral sequence reconstruction techniques can identify key mutations that emerged during adaptation to high temperatures. Codon usage analysis comparing crcB genes across temperature gradients may reveal temperature-specific optimization patterns. Synteny analysis examining gene neighborhoods can provide insights into functional associations and horizontal gene transfer events. These analyses should be performed on a comprehensive dataset including representatives from all major thermophilic bacterial lineages to capture the full diversity of crcB adaptation strategies .

What experimental approaches can researchers use to study how crcB1 has evolved for function in thermophilic environments?

To study the evolutionary adaptations of crcB1 for thermophilic environments, researchers should implement an integrated experimental approach. Begin by reconstructing ancestral crcB sequences using maximum likelihood methods based on phylogenetic analysis, then express and characterize these proteins to identify functional shifts during thermophilic adaptation. Generate chimeric proteins by systematically exchanging domains between thermophilic crcB1 and mesophilic homologs, followed by thermal stability and functional assays to identify regions contributing to thermoadaptation. Conduct parallel evolution experiments with mesophilic bacteria expressing crcB under gradually increasing temperature selection, sequencing evolved variants to identify convergent adaptive mutations. For mechanistic insights, perform comparative crystallography or cryo-EM on thermophilic versus mesophilic crcB proteins, focusing on structural features conferring thermostability such as ion pairs, hydrophobic packing, and loop stabilization. Hydrogen-deuterium exchange mass spectrometry at different temperatures can identify regions with differential conformational stability. Molecular dynamics simulations comparing protein motion at various temperatures (25-80°C) can reveal dynamic properties contributing to thermostability. These approaches should be conducted with careful controls and multiple replicates to ensure reproducibility of evolutionary insights .

How can crcB1 research contribute to our understanding of fluoride resistance mechanisms across different temperature environments?

Research on G. kaustophilus crcB1 can significantly advance our understanding of fluoride resistance mechanisms across temperature gradients by providing a thermophilic comparison point to mesophilic systems. Researchers should conduct comparative functional studies of crcB1 with mesophilic homologs at various temperatures (25-70°C) to identify temperature-dependent differences in transport kinetics, substrate specificity, and regulatory mechanisms. Structurally, identify adaptations that maintain fluoride channel function at elevated temperatures through comparative structural biology and mutagenesis experiments. Create a temperature-function relationship matrix documenting fluoride export efficiency across various temperatures for different crcB homologs. Beyond mechanistic insights, ecological studies examining fluoride resistance patterns in microbial communities across geothermal gradients can contextualize laboratory findings. This research has broader implications for understanding evolutionary adaptations of membrane transporters to extreme environments and may inform the development of thermostable fluoride biosensors or bioremediators for high-temperature industrial processes. The temperature-dependent properties of fluoride channels also serve as an excellent model system for studying how essential cellular functions adapt to environmental extremes .

What is the potential relationship between crcB1 function and insertion sequence transposition in the context of G. kaustophilus stress responses?

The relationship between crcB1 function and insertion sequence (IS) transposition in G. kaustophilus stress responses represents a fascinating research direction at the intersection of membrane transport and genome plasticity. The search results indicate that G. kaustophilus enhances IS transposition via sigX-dependent stress responses when proliferative cells encounter growth-inhibitory conditions, suggesting a potential regulatory link. To investigate this relationship, researchers should first determine if fluoride stress specifically triggers IS transposition by exposing cultures to sub-lethal fluoride concentrations and monitoring transposition events via Southern blotting. Generate crcB1 deletion mutants and assess whether the resulting fluoride sensitivity alters the frequency or pattern of IS transposition under various stressors. Transcriptomic analysis comparing wild-type and ΔcrcB1 strains under fluoride stress can identify differentially expressed genes involved in both stress response and transposition. ChIP-seq targeting SigX can determine if it directly regulates crcB1, IS elements, or both. Long-term evolution experiments under fluctuating fluoride concentrations can reveal if selective pressure for fluoride resistance influences IS-mediated genetic rearrangements affecting crcB1. This research may reveal novel connections between ion homeostasis maintenance and genome plasticity mechanisms, potentially uncovering how thermophiles employ genetic diversification strategies to adapt to environmental challenges .

What are the main challenges in expressing and purifying functional recombinant crcB1 protein, and how can researchers overcome them?

Expression and purification of functional recombinant crcB1 presents several challenges due to its thermophilic origin and membrane protein nature. The main challenges include protein misfolding in mesophilic hosts, aggregation during extraction, maintaining stability during purification, and achieving sufficient yield for structural studies. To overcome these challenges, researchers should:

  • Expression system selection: Use E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression, or consider Geobacillus-based expression systems for native-like folding.

  • Temperature optimization: Express at moderate temperatures (30-37°C) initially, followed by heat shock (45-55°C) to facilitate proper folding of the thermophilic protein.

  • Solubilization strategy: Test a panel of detergents including DDM, LMNG, and GDN at different concentrations (0.5-2% for extraction, 0.05-0.2% for purification) to identify optimal solubilization conditions.

  • Stabilization additives: Include glycerol (10-20%), specific lipids (POPE/POPG mixtures), and fluoride ions (1-5 mM) in buffers to maintain native conformation.

  • Purification approach: Implement a two-step purification using affinity chromatography followed by size exclusion chromatography, with all steps performed above room temperature.

  • Functional validation: Confirm activity through reconstitution into proteoliposomes and fluoride transport assays before proceeding to structural studies .

What methodological modifications are necessary when studying crcB1 protein-protein interactions at elevated temperatures?

When studying crcB1 protein-protein interactions at elevated temperatures, researchers must implement substantial methodological modifications to account for thermostability requirements. Standard techniques require the following adaptations:

  • Crosslinking approaches: Use thermostable crosslinkers like bismaleimidohexane (BMH) that remain stable at 60-70°C, with reaction times optimized for higher temperatures.

  • Pull-down assays: Implement heat-resistant affinity tags such as thermostable streptavidin or polyhistidine systems, and conduct binding steps at elevated temperatures (50-60°C) using thermostable buffers containing increased salt concentrations (250-500 mM) to reduce non-specific interactions.

  • Surface Plasmon Resonance: Modify commercial systems with heat-resistant flow cells and temperature-controlled sample compartments, and use reference channels with thermophilic non-interacting proteins.

  • Microscale Thermophoresis: This technique is particularly valuable as it inherently accounts for temperature effects; adjust infrared laser power to compensate for the already elevated sample temperature.

  • Native PAGE analysis: Formulate gels with increased acrylamide percentage (10-15%) and run at elevated temperatures using thermostable buffer systems.

  • In vivo approaches: For bacterial two-hybrid systems, adapt the reporter constructs to function in thermophilic hosts or use thermostable reporter proteins that maintain activity at high temperatures.

The experimental design should include temperature gradients rather than single-point measurements to characterize the temperature-dependence of observed interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.