Recombinant Geobacillus kaustophilus Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Description

Introduction

The protein "Recombinant Geobacillus kaustophilus Protein CrcB homolog 2 (CrcB2)" refers to a specific protein, CrcB2, derived from the thermophilic bacterium Geobacillus kaustophilus. G. kaustophilus is a Gram-positive bacterium known for its ability to thrive in high-temperature environments, making it valuable in various biotechnological applications . CrcB2 is a member of a poorly characterized set of proteins containing a domain of unknown function, DUF302 . CrcB2 is homologous to putative fluoride ion transporters, and is also known as FluC .

Geobacillus kaustophilus: Background

Geobacillus kaustophilus is a thermophilic bacterium, meaning it thrives in high-temperature environments . Its optimal growth temperature is around 50-70°C . G. kaustophilus has gained attention in biotechnology due to its thermostable enzymes, which are valuable in industrial processes conducted at high temperatures . G. kaustophilus GBlys is a lysogenic strain of the temperate phage phiOH2 . The genome of Geobacillus kaustophilus GBlys is 3,644,428 bp long, with a GC content of 52%, and contains 3,595 predicted protein-coding genes .

CrcB2 as a Homolog of Cgr2

CrcB2 shares homology with Cgr2, a reductase enzyme found in certain gut bacteria . Cgr2 is sufficient for digoxin reduction and is widespread in human gut microbiomes . Cgr2 is a homolog of flavin adenine dinucleotide (FAD)-dependent fumarate reductases and is predicted to undergo secretion via the twin arginine translocation (Tat) pathway .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB2; GK2703; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Geobacillus kaustophilus (strain HTA426)
Target Names
crcB2
Target Protein Sequence
MVYLAVGIAGMIGALVRYGLGLVVPAAAVGGFPLGTLFINWTGSFLLSWFTVMFTRRPAW PPWLKTAVTTGFVGSYTTFSTLSVECVELMEQGRFGMAAVYIAASLFGGLLASWAGYAAA QPERKEGIG
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links

KEGG: gka:GK2703

STRING: 235909.GK2703

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the crcB2 gene in Geobacillus kaustophilus?

The crcB2 gene is located within the 3.64 Mb genome of Geobacillus kaustophilus, which has a GC content of approximately 52% and contains 3,595 predicted protein-coding genes . While the specific location of crcB2 within this genome requires detailed analysis, researchers should examine the genomic neighborhood for potential operonic structures. To determine this experimentally:

  • Perform whole-genome sequencing using a combination of short-read (e.g., Illumina MiSeq) and long-read (e.g., Oxford Nanopore MinION) technologies

  • Assemble the genome with tools like SPAdes or Canu

  • Annotate the genome using PROKKA or RAST

  • Analyze the genomic context of the crcB2 gene using visualization tools such as Artemis

The complete G. kaustophilus chromosome has been sequenced to a depth of approximately 200× (MinION) and 60× (MiSeq), providing a reliable foundation for genomic analyses .

How can I clone the crcB2 gene from Geobacillus kaustophilus for recombinant expression?

Cloning the crcB2 gene from G. kaustophilus requires special consideration due to the thermophilic nature of this organism. A methodological approach includes:

  • Design primers based on the G. kaustophilus genome sequence with appropriate restriction sites

  • Extract genomic DNA using a specialized protocol for Gram-positive bacteria:

    • Grow G. kaustophilus at 55-60°C in appropriate media

    • Harvest cells during logarithmic growth phase

    • Treat with lysozyme (10 mg/ml) at 37°C for 30 minutes

    • Extract DNA using phenol-chloroform method or commercial kits optimized for Gram-positive bacteria

  • Amplify the crcB2 gene using high-fidelity DNA polymerase with thermostable properties

  • Clone the amplified gene into an expression vector compatible with either E. coli or B. subtilis

  • Verify the sequence to ensure no mutations were introduced during PCR

This approach takes advantage of the established G. kaustophilus genetic information while addressing the challenges of working with thermophilic DNA .

What expression systems are suitable for recombinant production of G. kaustophilus CrcB2 protein?

For functional expression of G. kaustophilus CrcB2, consider the following expression systems:

Expression HostAdvantagesDisadvantagesSpecial Considerations
E. coliWell-established, high yieldMay form inclusion bodiesCodon optimization may be necessary
B. subtilisGram-positive background, secretion capacityLower yields than E. coliRequires specialized vectors
G. kaustophilusNative environment, proper foldingChallenging transformationRequires thermostable selection markers

For optimal results with G. kaustophilus as host:

  • Use the pLS20-mediated conjugation system for DNA transfer from B. subtilis

  • Design an artificial DNA segment in B. subtilis chromosome containing the expression cassette

  • Transfer via conjugation into G. kaustophilus

  • Select transformants using thermostable antibiotic resistance markers

This approach overcomes the inherent difficulties in direct transformation of G. kaustophilus and leverages the natural advantages of working in the native host .

How can I genetically manipulate Geobacillus kaustophilus to study crcB2 function?

G. kaustophilus is known for its reluctance to standard genetic manipulation methods. A novel approach involves:

  • Design the genetic modification construct (knockout, reporter fusion, or overexpression) within an artificial DNA segment

  • Integrate this construct into the B. subtilis chromosome through homologous recombination

  • Transfer the construct to G. kaustophilus via pLS20-mediated conjugation:

    • Grow donor B. subtilis strain containing pLS20 plasmid and the target construct

    • Mix with recipient G. kaustophilus cells (ratio 1:1)

    • Incubate at 37°C for 90 minutes to allow conjugation

    • Plate on selective media and incubate at 55-60°C to eliminate B. subtilis

  • Confirm the genetic modification by PCR and sequencing

This methodology takes advantage of the plasticity of the B. subtilis genome and the simplicity of pLS20 conjugation, providing a powerful tool for studying gene function in G. kaustophilus .

What purification strategy should I use for recombinant G. kaustophilus CrcB2 protein?

Purifying CrcB2, like many membrane proteins, presents challenges that require specific approaches:

  • Express CrcB2 with appropriate affinity tags (His6 or Strep-tag) at either N- or C-terminus

  • Test multiple detergents for solubilization:

    • Mild detergents: DDM, LMNG

    • Harsh detergents: SDS, Triton X-100

    • Novel amphipathic polymers: SMA, DIBMA

  • Purification protocol:

    • Lyse cells using French press or sonication

    • Solubilize membranes with optimized detergent

    • Perform IMAC (Immobilized Metal Affinity Chromatography) at 4°C

    • Consider size exclusion chromatography as a polishing step

  • Assess protein purity by SDS-PAGE and Western blotting

  • Verify protein folding using circular dichroism spectroscopy

For thermostable proteins like those from G. kaustophilus, perform stability tests at elevated temperatures (50-70°C) to assess functional integrity post-purification. This approach is similar to the successful purification of IolQ from G. kaustophilus as a C-terminal histidine-tagged fusion protein in E. coli .

How can I assess the fluoride transport activity of G. kaustophilus CrcB2?

CrcB homologs are known to function as fluoride channels. To characterize CrcB2 transport activity:

  • Reconstitute purified CrcB2 into liposomes:

    • Prepare liposomes using E. coli polar lipids or synthetic lipids

    • Add purified CrcB2 at protein:lipid ratio of 1:100

    • Remove detergent by dialysis or bio-beads

  • Fluoride transport assay options:

    • Fluoride-selective electrode measurements

    • Fluorescent indicators (e.g., PBFI for indirect measurement)

    • Radioactive 18F uptake assays

  • Control experiments:

    • Protein-free liposomes

    • Heat-denatured CrcB2

    • Known fluoride channel inhibitors

  • Data analysis:

    • Calculate initial transport rates

    • Determine Km and Vmax values

    • Compare with other characterized CrcB homologs

These methodological approaches allow for quantitative assessment of transport activity under various conditions, including different pH values and temperatures relevant to the thermophilic nature of G. kaustophilus.

How does temperature affect the structure and function of G. kaustophilus CrcB2 compared to mesophilic homologs?

Given the thermophilic nature of G. kaustophilus, the CrcB2 protein likely possesses adaptations for high-temperature stability. To investigate:

  • Perform comparative structural analysis:

    • Express and purify CrcB2 from G. kaustophilus and mesophilic homologs

    • Determine thermal stability using differential scanning fluorimetry (DSF)

    • Compare secondary structure elements using circular dichroism at different temperatures

    • If possible, obtain structural data using X-ray crystallography or cryo-EM

  • Transport activity comparison:

    • Measure fluoride transport activity at temperature range (30-80°C)

    • Plot temperature optima for each homolog

    • Calculate activation energy from Arrhenius plots

  • Molecular dynamics simulation:

    • Build homology models of CrcB2 and mesophilic homologs

    • Run simulations at different temperatures (37°C vs. 60°C)

    • Analyze differences in protein flexibility, hydrogen bonding, and salt bridges

This approach will reveal the molecular basis of thermostability in G. kaustophilus CrcB2 and provide insights into the evolution of thermophilic membrane proteins.

What is the regulatory mechanism controlling crcB2 expression in G. kaustophilus?

Understanding the regulation of crcB2 expression requires a combination of bioinformatic and experimental approaches:

  • Promoter analysis:

    • Analyze the upstream region of crcB2 for potential regulatory elements

    • Look for palindromic sequences similar to known G. kaustophilus regulatory elements, such as the IolQ binding site consensus sequence 5′-RGWAAGCGCTTSCY-3′

    • Identify potential transcription factor binding sites using tools like MEME

  • Experimental verification:

    • Generate promoter-reporter fusions using the B. subtilis to G. kaustophilus transfer system

    • Measure expression under various conditions (different carbon sources, stress conditions)

    • Perform gel electrophoresis mobility shift assays (EMSA) with candidate regulatory proteins

    • Use DNase I footprinting to identify exact binding sites

  • Regulatory network integration:

    • Compare crcB2 regulation with other fluoride resistance genes

    • Investigate potential cross-talk with stress response systems

    • Develop a regulatory model integrating experimental findings

This systematic approach will reveal how G. kaustophilus regulates crcB2 expression in response to environmental conditions, similar to the well-characterized IolQ regulation of inositol metabolism .

How has the crcB2 gene evolved within the Geobacillus genus and related thermophilic bacteria?

Evolutionary analysis of crcB2 can provide insights into adaptation to high-temperature environments:

  • Perform comprehensive phylogenetic analysis:

    • Collect crcB homologs from diverse bacterial species

    • Align sequences using MUSCLE or MAFFT

    • Construct phylogenetic trees using maximum likelihood or Bayesian approaches

    • Map habitat temperature onto the phylogeny

  • Calculate selection pressures:

    • Compare synonymous vs. non-synonymous substitution rates (dN/dS)

    • Identify sites under positive selection using PAML or HyPhy

    • Correlate selective pressure with functional domains

  • Comparative genomics:

    • Analyze gene neighborhood conservation across species

    • Identify horizontal gene transfer events

    • Compare G. kaustophilus crcB2 with the seven other G. kaustophilus strains registered in the NCBI database

The evolutionary patterns revealed may correlate with adaptations to specific environmental niches and provide insights into the functional importance of CrcB2 in thermophilic bacteria.

Why might recombinant G. kaustophilus CrcB2 show poor expression in heterologous systems?

Several factors can contribute to poor expression of thermophilic membrane proteins:

  • Codon usage bias:

    • Analyze codon adaptation index (CAI) for crcB2 in different expression hosts

    • Consider synthesizing a codon-optimized gene for the chosen expression system

    • Test different codon optimization algorithms (e.g., harmonization vs. optimization)

  • Membrane protein insertion challenges:

    • Try different signal sequences or fusion partners

    • Test expression at lower temperatures (18-25°C)

    • Consider specialized E. coli strains (C41/C43, Lemo21)

  • Protein toxicity:

    • Use tightly regulated inducible promoters

    • Decrease induction strength or time

    • Test toxicity using growth curve analysis with different induction conditions

  • Experimental troubleshooting matrix:

ParameterVariables to TestDetection Method
Temperature18°C, 25°C, 30°C, 37°CWestern blot, fluorescence
Induction0.01-1 mM IPTG or 0.001-0.2% arabinoseWestern blot, activity assay
Host strainBL21(DE3), C41, C43, RosettaComparative expression levels
MediaLB, TB, autoinductionCell density, protein yield

Systematic troubleshooting using this approach will help identify optimal conditions for functional expression of G. kaustophilus CrcB2.

How can I confirm the specificity of CrcB2 for fluoride versus other halides?

Establishing ion selectivity is crucial for functional characterization:

  • Design competitive transport assays:

    • Reconstitute CrcB2 in liposomes as described earlier

    • Perform transport assays with fluoride in the presence of increasing concentrations of other halides (Cl-, Br-, I-)

    • Calculate inhibition constants (Ki) for each competing ion

  • Binding studies:

    • Develop a thermal shift assay with different halides

    • Measure binding affinities using isothermal titration calorimetry (ITC)

    • Compare binding energetics across different halides

  • Electrophysiology:

    • Reconstitute CrcB2 in planar lipid bilayers

    • Measure single-channel conductance for different halides

    • Determine ion selectivity from reversal potentials

  • Specificity verification using mutagenesis:

    • Identify conserved residues predicted to be involved in ion selectivity

    • Generate point mutations at these positions

    • Assess changes in selectivity profile

This multi-pronged approach will establish the ion selectivity profile of G. kaustophilus CrcB2 and provide insights into the molecular basis of fluoride specificity.

What strategies can address data inconsistencies when studying G. kaustophilus CrcB2 function across different experimental systems?

Researchers often encounter contradictory results when studying the same protein in different experimental contexts:

  • Standardize experimental conditions:

    • Establish a consistent buffer system that works across methods

    • Maintain the same temperature range relevant to G. kaustophilus physiology

    • Use the same protein preparation for comparative studies

  • Controlled comparative analysis:

    • Test activity in multiple experimental systems in parallel

    • Validate key findings using alternative methodological approaches

    • Establish positive and negative controls for each system

  • Address the impact of experimental environment:

    • For in vitro studies, vary lipid composition to mimic G. kaustophilus membranes

    • For heterologous expression, compare results in mesophilic vs. thermophilic hosts

    • Consider the effect of growth phase on protein function when using whole-cell assays

  • Data integration framework:

    • Develop a quantitative model that accounts for experimental variables

    • Use Bayesian approaches to reconcile contradictory datasets

    • Implement structured experimental design with statistical power analysis

By systematically addressing variables across experimental systems, researchers can develop a coherent understanding of G. kaustophilus CrcB2 function despite initial data inconsistencies.

How can G. kaustophilus CrcB2 be engineered for enhanced fluoride transport properties?

Protein engineering offers opportunities to enhance or modify CrcB2 function:

  • Structure-guided mutagenesis:

    • Identify key residues in the channel pore

    • Design mutations to alter pore diameter or surface charge

    • Test variants using transport assays described earlier

  • Directed evolution approach:

    • Develop a fluoride sensitivity selection system in G. kaustophilus or B. subtilis

    • Create a mutagenized crcB2 library using error-prone PCR

    • Select variants with enhanced fluoride transport under selective pressure

    • Sequence and characterize improved variants

  • Chimeric protein design:

    • Identify regions of sequence divergence between CrcB homologs

    • Create chimeric proteins swapping domains between thermophilic and mesophilic homologs

    • Analyze thermal stability and transport activity of chimeras

This research direction could lead to engineered proteins with applications in fluoride bioremediation or as components in biosensors operating at elevated temperatures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.