Recombinant Geobacillus kaustophilus UPF0059 membrane protein GK3374 (GK3374)

What is the structural composition of GK3374 membrane protein?

GK3374 is a UPF0059 membrane protein from Geobacillus kaustophilus (strain HTA426) with 183 amino acids. The complete amino acid sequence is:
MGAFIGEIIALSMMALALGMDAFSVALGMGLLRLRLRQMFYIGLTIGLFHILMPLAGMAVGRLLSREFGSVATYAGGALLLWLGGQMIIASFRRDDGSPLFPRGVGLLFFAFSVSLDSFS VGLSLGIFGARTMVTILLFGLFSMVLTWVGLFVGRHFQQWLGSYSEALGGSILLAFGLKLLFL

Based on the sequence analysis, this protein contains multiple hydrophobic regions consistent with its membrane-spanning domains. The protein, also identified by target name mntP, belongs to the UPF0059 family of membrane proteins, which are still being functionally characterized across bacterial species .

What are the optimal storage conditions for preserving GK3374 protein activity?

The preservation of GK3374 protein activity is highly dependent on appropriate storage conditions. For liquid formulations, the recommended storage temperature is -20°C/-80°C with an expected shelf life of approximately 6 months. Lyophilized formulations offer extended stability with a shelf life of 12 months when stored at -20°C/-80°C .

Importantly, repeated freeze-thaw cycles should be avoided as they significantly decrease protein stability and functional activity. For ongoing experiments requiring frequent access, working aliquots should be stored at 4°C, but their use should be limited to one week to maintain protein integrity .

A storage buffer containing Tris-based components with 50% glycerol has been optimized specifically for this protein to enhance stability and prevent degradation during storage periods .

How should recombinant GK3374 protein be reconstituted for experimental use?

The reconstitution process for GK3374 requires careful attention to maintain protein integrity. The recommended protocol involves:

• Brief centrifugation of the vial prior to opening to ensure all contents are collected at the bottom

• Reconstitution in deionized sterile water to achieve a final concentration of 0.1-1.0 mg/mL

• Addition of glycerol to a final concentration of 5-50% (with 50% being the standard recommended concentration)

• Gentle mixing to ensure complete solubilization without introducing air bubbles or causing protein denaturation

• Preparation of working aliquots to minimize freeze-thaw cycles

This methodology ensures optimal solubilization while maintaining the structural integrity and functional properties of the membrane protein, which is particularly important given the hydrophobic nature of GK3374 .

What crystallization techniques are most effective for structural analysis of thermophilic membrane proteins like GK3374?

While specific crystallization data for GK3374 is not directly available in the search results, insights can be drawn from crystallization techniques used for other proteins from Geobacillus kaustophilus. Based on related studies, the following methodological approach is recommended:

• Protein purification should achieve >85% purity (as measured by SDS-PAGE) to facilitate successful crystallization

• The hanging-drop vapor-diffusion method has proven effective for crystallizing proteins from thermophilic organisms, as demonstrated with GK0767 (another protein from G. kaustophilus)

• For membrane proteins like GK3374, detergent screening is crucial, with mild detergents such as n-dodecyl-β-D-maltoside (DDM) often being effective for initial solubilization while maintaining native conformation

Optimization parameters that should be systematically varied include:

• Protein concentration (typically 5-15 mg/mL)

• Precipitant type and concentration

• Buffer composition and pH

• Temperature (typically room temperature and 4°C)

• Additives that may enhance crystal formation

The crystallization process for membrane proteins typically requires more extensive screening conditions compared to soluble proteins due to their hydrophobic nature .

How can researchers effectively express and purify GK3374 for functional studies?

Expression and purification of membrane proteins like GK3374 present unique challenges that require specialized protocols:

• Expression System Selection: While the commercial GK3374 is expressed in yeast , heterologous expression in E. coli has proven successful for other G. kaustophilus proteins . For membrane proteins, specialized E. coli strains like C41(DE3) or C43(DE3) often yield better results than standard BL21(DE3).

• Expression Optimization:

  • Induction at lower temperatures (16-25°C) often improves membrane protein folding

  • IPTG concentration should be optimized (typically 0.1-0.5 mM)

  • Extended expression times (16-24 hours) at reduced temperatures may increase yield

  • Co-expression with chaperones may improve folding efficiency

• Purification Strategy:

  • Initial solubilization with carefully selected detergents (DDM, LDAO, or OG)

  • Affinity chromatography using the tag provided during recombinant expression

  • Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Ion exchange chromatography for further purification if necessary

• Quality Assessment:

  • SDS-PAGE to confirm purity (target >85%)

  • Western blotting for identity confirmation

  • Dynamic light scattering to assess homogeneity

  • Circular dichroism to verify secondary structure integrity

This comprehensive approach maximizes the likelihood of obtaining functionally active GK3374 suitable for downstream applications .

What functional assays can be used to characterize the activity of GK3374 membrane protein?

Based on the protein's classification and predicted function, the following methodological approaches can be implemented to characterize GK3374 activity:

• Transport Assays: As mntP designation suggests possible involvement in metal transport , researchers should consider:

  • Fluorescence-based metal ion uptake assays using fluorophores sensitive to specific metal ions

  • Radioactive isotope transport assays measuring uptake or efflux kinetics

  • Liposome reconstitution assays to study transport in a controlled membrane environment

• Binding Assays:

  • Isothermal titration calorimetry (ITC) to determine binding affinities for potential substrates

  • Microscale thermophoresis (MST) for detecting interactions with ligands

  • Surface plasmon resonance (SPR) to measure real-time binding kinetics

• Structural Changes Upon Substrate Binding:

  • Circular dichroism to detect conformational changes

  • Hydrogen-deuterium exchange mass spectrometry to identify regions involved in substrate binding

  • FRET-based assays with strategically labeled protein to detect conformational dynamics

• In vivo Functional Complementation:

  • Heterologous expression in knockout bacterial strains lacking homologous proteins

  • Phenotypic rescue experiments to validate function

These assays should be performed under conditions that account for the thermophilic nature of the protein, typically at elevated temperatures (50-60°C) that reflect the native environment of Geobacillus kaustophilus .

How should researchers design experiments to compare GK3374 with homologous proteins from mesophilic bacteria?

When designing comparative studies between the thermophilic GK3374 and its mesophilic counterparts, researchers should implement the following methodological framework:

• Homolog Identification and Selection:

  • Perform comprehensive sequence alignment using tools like BLAST and HMM profiles

  • Select homologs spanning diverse phylogenetic relationships

  • Include both close homologs (>70% sequence identity) and distant homologs (30-50% identity)

• Standardized Expression and Purification:

  • Use identical expression systems and tags for all proteins

  • Implement parallel purification protocols with adjustments only for temperature-sensitive steps

  • Verify comparable purity levels (>85% by SDS-PAGE) for all proteins

• Thermal Stability Assessment:

  • Circular dichroism melting curves at temperatures ranging from 20-90°C

  • Differential scanning calorimetry to determine precise melting temperatures

  • Activity retention assays after heat treatment at various temperatures

• Functional Parameter Comparison:

  Parameter	Experimental Method	Data Analysis Approach
  Substrate affinity	Isothermal titration calorimetry	Determination of Kd values
  Reaction/transport kinetics	Real-time activity assays	Calculation of Vmax and Km
  pH optimum	Activity assays across pH range	Gaussian fitting to identify optimum
  Temperature optimum	Activity assays across temperature range	Determination of temperature coefficient (Q10)
  Structural flexibility	Hydrogen-deuterium exchange	Calculation of exchange rates

• Structural Comparison:

  • X-ray crystallography under comparable conditions

  • Cryo-EM analysis if applicable

  • Computational modeling to identify key structural differences

This systematic approach ensures meaningful comparison of thermophilic adaptations while minimizing experimental variables that could confound results .

What controls should be included when studying the effect of temperature on GK3374 activity?

Given the thermophilic origin of GK3374, temperature-dependent studies require carefully designed controls:

• Positive and Negative Controls:

  • Include a known thermostable protein (positive control) and a mesophilic homolog (negative control)

  • Empty vector/purification from non-transformed cells as background control

  • Heat-denatured GK3374 as inactive protein control

• Temperature Gradient Design:

  • Use minimum 8-10 temperature points ranging from 30-80°C

  • Include narrower intervals (5°C steps) around predicted optimal temperature

  • Perform time-course experiments at each temperature point to distinguish activity from stability effects

• Buffer and pH Considerations:

  • Use temperature-stable buffers like phosphate or HEPES

  • Pre-adjust pH at each experimental temperature (accounting for ΔpKa/°C)

  • Control for buffer evaporation at higher temperatures

• Equipment Calibration:

  • Verify temperature probes accuracy using secondary measurement methods

  • Allow sufficient equilibration time at each temperature point

  • Conduct parallel measurements with temperature-sensitive dyes to verify actual sample temperature

• Data Normalization Approach:

  • Report relative activities normalized to optimal conditions

  • Calculate activation energy using Arrhenius plots

  • Perform statistical analysis accounting for temperature-dependent measurement errors

This comprehensive control framework ensures that observed effects are genuinely attributed to temperature rather than experimental artifacts .

How can researchers optimize crystallization conditions for structure determination of GK3374?

The optimization of crystallization conditions for membrane proteins like GK3374 requires a systematic approach:

• Initial Screening Strategy:

  • Implement sparse matrix screens specifically designed for membrane proteins

  • Use both vapor diffusion (hanging and sitting drop) methods as demonstrated effective for other G. kaustophilus proteins

  • Test protein concentrations ranging from 5-15 mg/mL

  • Screen multiple detergents (DDM, LDAO, OG, etc.) at concentrations just above their CMC

• Optimization Parameters:

  Parameter	Variation Range	Increment Steps
  Precipitant concentration	50-150% of initial hit	10% steps
  pH	±1.0 unit from initial hit	0.2 unit steps
  Temperature	4°C, 16°C, 20°C	Fixed points
  Protein:reservoir ratio	1:1, 1:2, 2:1	Fixed ratios
  Additive screening	Commercial screens	According to kit

• Advanced Techniques:

  • Lipidic cubic phase (LCP) crystallization for challenging membrane proteins

  • Bicelle-based crystallization methods

  • Use of antibody fragments (Fab, nanobody) to increase polar surface area

  • Controlled dehydration of initial crystals to improve diffraction quality

• Crystal Handling and Data Collection:

  • Optimize cryoprotectant conditions (typically 25% glycerol or other cryoprotectants)

  • Test multiple crystals for diffraction quality

  • Collect complete datasets with appropriate oscillation angles

  • Process diffraction data using standard crystallographic software packages

By systematically exploring these parameters, researchers can identify conditions that yield diffraction-quality crystals suitable for structural studies of GK3374 .

How should researchers interpret conflicting results between in vitro and in vivo studies of GK3374 function?

When faced with discrepancies between in vitro and in vivo functional data for GK3374, researchers should implement the following analytical framework:

• Systematic Comparison of Experimental Conditions:

  • Document all differences in protein concentration, buffer composition, temperature, and pH

  • Evaluate the presence/absence of cofactors or binding partners in different experimental systems

  • Assess membrane composition differences between in vitro models and native environment

• Functional State Verification:

  • Confirm proper folding using circular dichroism or fluorescence spectroscopy

  • Verify oligomerization state using size exclusion chromatography or native PAGE

  • Assess post-translational modifications that might differ between systems

• Reconciliation Approaches:

  • Design hybrid experiments that progressively increase complexity from in vitro to in vivo

  • Implement membrane mimetics (nanodiscs, liposomes) that better approximate cellular conditions

  • Employ in-cell NMR or fluorescence microscopy to bridge the methodological gap

• Statistical Analysis Framework:

  Analysis Type	Purpose	Implementation
  Multivariate analysis	Identify key variables affecting discrepancies	Principal component analysis of all experimental parameters
  Sensitivity analysis	Determine which conditions most affect results	Systematic variation of individual parameters
  Bootstrapping	Assess robustness of observed differences	Resampling experimental data to estimate confidence intervals

• Theoretical Modeling:

  • Develop mathematical models incorporating parameters from both systems

  • Use molecular dynamics simulations to assess behavior under different conditions

  • Implement Bayesian analysis to integrate diverse data sources

This systematic approach helps researchers discern whether discrepancies represent genuine biological phenomena versus experimental artifacts, leading to more accurate functional characterization .

What statistical methods should be used when analyzing temperature-dependent kinetic data for GK3374?

The analysis of temperature-dependent kinetic data for thermophilic proteins like GK3374 requires specialized statistical approaches:

• Preprocessing Steps:

  • Outlier detection and handling using modified Z-score methods

  • Normalization approaches accounting for temperature-dependent instrument baseline shifts

  • Assessment of measurement precision across temperature range using technical replicates

• Primary Analysis Methods:

  • Non-linear regression fitting to appropriate kinetic models (Michaelis-Menten, Hill equation)

  • Arrhenius plots for activation energy determination

  • Eyring analysis for thermodynamic parameter extraction (ΔH‡, ΔS‡, ΔG‡)

• Advanced Statistical Techniques:

  • Hierarchical Bayesian modeling to account for nested experimental designs

  • Bootstrap aggregation for robust parameter estimation across temperature ranges

  • Model selection using Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC)

• Validation Approaches:

  Validation Method	Purpose	Implementation
  Cross-validation	Test predictive accuracy	k-fold cross-validation across temperature subsets
  Residual analysis	Detect systematic deviations	Plots of standardized residuals vs. temperature
  Sensitivity analysis	Identify influential data points	Leave-one-out analysis for each temperature point

• Visual Representation:

  • 3D surface plots showing activity as a function of both temperature and substrate concentration

  • Contour plots highlighting optimal temperature-pH combinations

  • Comparative plots with homologous proteins using consistent scales and transformations

This comprehensive statistical framework ensures robust interpretation of temperature effects on GK3374 kinetics while accounting for the unique challenges of thermostable enzyme characterization .

How can researchers effectively compare crystallographic data for GK3374 with related membrane proteins?

Comparative crystallographic analysis of GK3374 with related membrane proteins requires methodological rigor:

• Data Quality Assessment:

  • Evaluate resolution, R-factors, and validation statistics for all structures

  • Assess completeness of data in reciprocal space

  • Analyze B-factor distributions to identify regions of uncertainty

  • Confirm absence of crystallographic artifacts

• Structural Alignment Strategy:

  • Global alignments using Cα positions of conserved secondary structure elements

  • Local alignments of functional domains and active sites

  • Quantitative comparison using RMSD values and per-residue deviation plots

  • Multiple structure alignment when comparing >2 proteins

• Feature Comparison Framework:

  Structural Feature	Analysis Method	Quantification Approach
  Secondary structure composition	DSSP or STRIDE algorithms	Percentages of helix, sheet, coil
  Functional site architecture	Superposition of catalytic residues	RMSD of key side chains
  Cavity/channel dimensions	CAVER, MOLE, or HOLLOW software	Volume and cross-sectional area measurements
  Electrostatic surface	Adaptive Poisson-Boltzmann Solver	Spatial correlation coefficients

• Molecular Interface Analysis:

  • Identify crystal contacts vs. biological interfaces

  • Quantify interface area and complementarity

  • Analyze conservation patterns across interfaces

  • Verify oligomeric state consistency with solution studies

• Environmental Adaptation Features:

  • Compare ion-pair networks in thermophilic vs. mesophilic homologs

  • Analyze amino acid composition bias in surface vs. core regions

  • Quantify structural rigidity through B-factor analysis

  • Assess proline and glycine distribution in loop regions

This systematic comparative approach provides insights into structure-function relationships while accounting for differences in crystallization conditions, crystal packing, and data collection parameters .