Recombinant Geobacillus kaustophilus UPF0344 protein GK0697 (GK0697)

What is the structural composition of Geobacillus kaustophilus UPF0344 protein GK0697?

GK0697 is a 117-amino acid protein from the thermophilic bacterium Geobacillus kaustophilus strain HTA426. The full amino acid sequence is: MTHAHITSWLITIVLFFLAVSMERQGAGKAKIVQMVLRLFYILTIVTGLLLLHSIASISALYWLKALAGLWVIGAMEMVLAAEKKGKSAAARWTQWVIALAVTLFLGLLLPLGFDLF . Structural analysis indicates it is a membrane protein with multiple transmembrane domains. The protein belongs to the UPF0344 family, a group of uncharacterized proteins found across various bacterial species. While no crystal structure has been published specifically for GK0697, sequence analysis suggests the presence of hydrophobic regions characteristic of membrane-spanning domains.

What are the optimal storage conditions for recombinant GK0697?

For maximum stability and activity retention, store recombinant GK0697 at -20°C/-80°C for long-term storage . The protein is typically supplied in Tris-based buffer with either glycerol (50%) or as a lyophilized powder . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they lead to protein degradation . For reconstitution of lyophilized protein, the recommended procedure is to briefly centrifuge the vial before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, followed by addition of glycerol (5-50% final concentration) for long-term storage .

What expression systems are effective for producing recombinant GK0697?

The primary expression system used for recombinant production of GK0697 is Escherichia coli . The protein can be expressed with various fusion tags, with His-tag being commonly utilized to facilitate purification through immobilized metal affinity chromatography . When expressing this thermophilic protein in a mesophilic host like E. coli, careful optimization of growth temperature, induction conditions, and media composition is necessary to maximize protein folding efficiency while minimizing inclusion body formation. Expression trials at various temperatures (typically 16-30°C) following induction may be required to determine optimal conditions for soluble protein production.

How can researchers verify the purity and identity of recombinant GK0697?

Verification of recombinant GK0697 purity and identity should follow a multi-step approach:

For recombinant GK0697, purity greater than 90% as determined by SDS-PAGE is typically achieved following appropriate purification protocols .

What transformation methods are most effective for genetic manipulation of Geobacillus kaustophilus?

Genetic manipulation of G. kaustophilus presents unique challenges due to its resistance to conventional transformation methods including natural competence and electroporation . Recent methodological advances have significantly improved transformation efficiency:

• pLS20catΔoriT-mediated conjugation: This method facilitates the transfer of genetic material from Bacillus subtilis to G. kaustophilus . The system utilizes a plasmid pLS20catΔoriT to mobilize DNA transfer, enabling effective introduction of genetic elements into G. kaustophilus.

• Chromosomal integration strategy: Construction of a gene cassette within B. subtilis chromosome followed by pLS20catΔoriT-mediated conjugation allows for specific genetic integration into G. kaustophilus . This method has been demonstrated to successfully transfer gene cassettes from B. subtilis into G. kaustophilus, allowing for targeted genetic modification.

• Verification methods: Southern blotting analysis is recommended to verify correct integration and rule out non-specific recombination events . This involves digestion of genomic DNA with appropriate restriction enzymes followed by hybridization with probes specific to the introduced genetic elements.

This conjugation-based approach provides an effective alternative to previously described methods that relied on counterselection, which was problematic for mutations adversely affecting growth .

How can functional assays be designed to characterize the biological role of GK0697?

Given the uncharacterized nature of GK0697, a comprehensive approach to functional characterization would include:

• Gene knockout/knockdown studies: Creating a GK0697 deletion mutant in G. kaustophilus using the pLS20catΔoriT-mediated conjugation method . Phenotypic comparison between wild-type and mutant strains under various growth conditions can reveal functional implications. This may include analysis of growth rates, membrane integrity, stress responses, and metabolic profiles.

• Transcriptomic analysis: Quantitative RT-PCR similar to the methods described for analyzing iol transcripts in G. kaustophilus can be adapted to study expression patterns of GK0697 under various conditions. This approach can identify environmental or metabolic conditions that regulate GK0697 expression.

• Subcellular localization: As a predicted membrane protein, confirming the localization of GK0697 within the bacterial membrane is essential. This can be achieved through membrane fractionation followed by Western blotting, or through fusion with fluorescent reporters adapted for thermophilic conditions.

• Structural studies: Given the small size of GK0697 (117 amino acids), NMR spectroscopy might be feasible for structural determination if the protein can be produced in isotopically labeled form and purified in a stable, solubilized state.

What are the unique challenges in purifying membrane proteins like GK0697 from thermophilic bacteria?

Purification of membrane proteins from thermophilic organisms presents several distinct challenges:

• Membrane extraction efficiency: The rigid membrane structures of thermophilic bacteria, adapted to high temperatures, can reduce extraction efficiency using conventional detergents employed for mesophilic membrane proteins.

• Detergent selection: A systematic screen of different detergents is critical for maintaining protein stability and function. For thermophilic membrane proteins like GK0697, detergents with higher thermal stability may be required.

• Temperature considerations during purification: While purification at elevated temperatures might better mimic native conditions, it can accelerate detergent degradation and increase risk of proteolytic activity.

An optimized purification protocol for GK0697 would typically include:

How can researchers design experiments to investigate the temperature-dependent properties of GK0697?

G. kaustophilus grows optimally at 60°C with a range of 48-74°C , suggesting GK0697 may have evolved temperature-dependent properties. Experimental approaches should include:

• Thermal stability analysis: Using methods like differential scanning calorimetry (DSC) or thermal shift assays modified for membrane proteins to determine the melting temperature and unfolding characteristics across a temperature range.

• Temperature-dependent activity assays: If a functional assay can be established, measuring activity at different temperatures (45-80°C) can determine optimal functional temperature and thermal activity profile.

• Structural changes monitoring: Circular dichroism spectroscopy to observe potential secondary structure changes as a function of temperature, providing insights into structural adaptations that contribute to thermostability.

• Expression profiling: Quantitative RT-PCR analysis similar to that used for iol transcripts in G. kaustophilus to determine if GK0697 expression is thermoregulated.

• Comparative analysis: Comparison with homologous proteins from mesophilic organisms to identify specific adaptations that confer thermostability to GK0697.

What proteomics approaches are most suitable for identifying potential interaction partners of GK0697?

Given the membrane localization of GK0697, specialized proteomics approaches are required:

• Affinity purification coupled with mass spectrometry (AP-MS): Using His-tagged GK0697 as bait to identify co-purifying proteins. Critical considerations include:

  • Mild solubilization conditions to preserve protein-protein interactions

  • Crosslinking to stabilize transient interactions prior to purification

  • Stringent controls to distinguish specific interactions from background

• Proximity labeling techniques: Methods such as BioID or APEX2 where a proximity-based labeling enzyme is fused to GK0697, allowing biotinylation of proximal proteins that can later be purified and identified by mass spectrometry.

• Chemical crosslinking followed by mass spectrometry (XL-MS): Particularly useful for membrane proteins where interactions may occur within the lipid bilayer environment.

• Bacterial two-hybrid systems: Modified for thermophilic conditions to detect protein-protein interactions in vivo.

How can site-directed mutagenesis be applied to understand structure-function relationships in GK0697?

For an uncharacterized protein like GK0697, site-directed mutagenesis provides a powerful approach to probe structure-function relationships:

• Conservation analysis: Multiple sequence alignment of GK0697 homologs to identify highly conserved residues, which likely have functional significance and should be prioritized for mutagenesis.

• Transmembrane topology mapping: Systematic mutagenesis of residues predicted to be at membrane interfaces or within transmembrane domains to confirm topology models and identify functionally important regions.

• Charge-swap experiments: For charged residues that might be involved in ion coordination or electrostatic interactions, performing charge reversals (e.g., Asp→Arg) can provide evidence for their functional roles.

• Aromatic residue modifications: Aromatic residues often play critical roles in membrane protein folding and stability. Systematic replacement with alanine can identify essential structural elements.

• Mutagenesis verification: For each mutant, expression levels, membrane localization, and folding status should be verified to distinguish between mutations affecting protein stability versus those specifically impacting function.

What experimental approaches would be appropriate for determining if GK0697 is involved in stress response pathways in G. kaustophilus?

To investigate potential roles in stress response:

• Transcriptional profiling: Quantitative RT-PCR analysis, similar to that used for iol transcripts , to measure GK0697 expression under various stress conditions including:

  • Heat shock (temperature upshift)

  • Oxidative stress (H₂O₂ exposure)

  • Osmotic stress (high salt concentration)

  • pH stress (acid/alkaline conditions)

  • Nutrient limitation

• Comparative phenotyping: Creating a GK0697 knockout strain using the pLS20catΔoriT-mediated conjugation system and comparing its survival rates under various stress conditions relative to wild-type.

• Promoter analysis: Examining the promoter region of GK0697 for known stress-responsive elements, potentially using approaches similar to those used to study iolQ-regulated gene expression .

• Proteome-wide interaction studies: Identifying if GK0697 interacts with known stress response proteins using the proteomics approaches outlined earlier.

How can researchers effectively compare the functional characteristics of GK0697 with homologous proteins from mesophilic bacteria?

A comprehensive comparative analysis would include:

• Homology identification: Bioinformatic identification of UPF0344 family proteins across bacterial species with varying optimal growth temperatures.

• Heterologous expression: Expressing both GK0697 and mesophilic homologs in the same host system to enable direct comparison of biochemical properties.

• Thermal stability comparison: Measuring protein stability parameters (melting temperature, half-life at various temperatures) for both GK0697 and mesophilic homologs using identical experimental conditions.

• Complementation studies: Testing whether GK0697 can functionally complement a knockout of its homolog in a mesophilic bacterium, and vice versa.

• Structural analysis: Comparing amino acid composition, predicted secondary structure elements, and potential stabilizing features (e.g., salt bridges, hydrophobic packing) between thermophilic and mesophilic variants.

• Chimeric protein construction: Creating fusion proteins with domains from both thermophilic GK0697 and mesophilic homologs to identify regions responsible for specific functional or stability properties.