Recombinant Geobacillus sp. Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
mscL; GWCH70_1285; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Geobacillus sp. (strain WCH70)
Target Names
mscL
Target Protein Sequence
MWKEFKEFAMRGNVVDLAVGVIIGGAFGKIVSSLVNDILMPLVGLLLGGVDFSGLSWKFG KAVVKYGMFIQTVVDFFIISFSIFVFVKVLNKLYWHNKKEEEIKDTAPTLTKEEELLMEI RDLLKQQRETR
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the mscL channel and what is its physiological role in bacterial cells?

The mechanosensitive channel of large conductance (mscL) functions as a biological emergency release valve that prevents cell lysis when bacteria experience extreme decreases in osmotic environment. This channel opens in response to membrane tension, creating a large pore that allows the rapid efflux of cytoplasmic solutes, thereby relieving pressure that would otherwise lead to cell rupture.

MscL forms the largest gated pore known in biology, capable of passing molecules up to 30 Å in diameter. This remarkable property makes it particularly valuable for studying mechanosensation at the molecular level .

The physiological importance of mscL has been definitively demonstrated through genetic studies. Double null mutants lacking both mscL and mscS (mechanosensitive channel of small conductance) display an osmotic-sensitive phenotype with dramatically decreased viability upon osmotic downshock .

How is recombinant Geobacillus sp. mscL typically expressed and purified for research applications?

Recombinant Geobacillus sp. mscL is typically expressed in E. coli expression systems using the following methodology:

  • Expression vector construction: The mscL gene (typically 396bp encoding 131 amino acids) is cloned into bacterial expression vectors such as pET series vectors with either N-terminal or C-terminal His-tags to facilitate purification .

  • Expression conditions: The protein is expressed in E. coli host strains such as BL21(DE3) or JM109(DE3)(pLysS) grown in rich media (Terrific Broth or LB) supplemented with appropriate antibiotics .

  • Induction: Protein expression is induced using IPTG (typically 0.4 mM) when culture reaches OD600 of 0.6-0.8, followed by growth at temperatures between 18-37°C depending on protein solubility requirements .

  • Cell lysis: Cells are harvested by centrifugation and disrupted using methods such as French press, sonication, or cell disruptors in buffer containing:

    • 20-50 mM Tris or phosphate buffer (pH 7.0-8.0)

    • 100-500 mM NaCl

    • Sometimes supplemented with glycerol and protease inhibitors

  • Purification: The protein is purified using:

    • Immobilized metal affinity chromatography (IMAC) with Ni-NTA columns

    • Size exclusion chromatography for further purification

    • Buffer exchange to remove imidazole

  • Storage: The purified protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, either as a lyophilized powder or in solution with added glycerol (5-50%) and stored at -20°C to -80°C .

What are the structural features of Geobacillus sp. mscL protein?

The Geobacillus sp. mscL protein exhibits several key structural features:

  • Size and composition: The full-length protein consists of 131 amino acids with a molecular weight of approximately 15 kDa .

  • Transmembrane domains: Computational and spectroscopic analyses reveal that mscL possesses two helical transmembrane domains (TM1 and TM2). Circular dichroism spectroscopy confirms the protein is highly helical both in detergents and liposomes .

  • Channel structure: MscL forms a homopentameric complex with a central pore. When closed, the pore is constricted by a hydrophobic gate; upon membrane tension, the channel undergoes substantial conformational changes that expand the pore diameter to allow passage of solutes and small molecules .

  • Conserved motifs: MscL contains a consensus motif N-h-h-D (where h represents hydrophobic amino acids) that is shared with many channel families and plays important functional roles .

Why is the thermostability of Geobacillus sp. proteins valuable for research applications?

The thermostability of Geobacillus sp. proteins, including mscL, offers several distinct advantages for research applications:

  • Enhanced structural stability: Proteins from thermophilic bacteria like Geobacillus sp. typically demonstrate greater structural stability at both elevated and ambient temperatures, making them more amenable to various experimental manipulations and structural studies .

  • Increased expression yields: Thermostable proteins often fold more efficiently when expressed recombinantly in mesophilic hosts like E. coli, potentially resulting in higher yields of properly folded, functional protein .

  • Extended shelf life: Thermostable proteins generally exhibit longer shelf lives and greater resistance to denaturation during storage and handling, reducing experimental variability .

  • Improved crystallization properties: The inherent stability of thermophilic proteins often facilitates successful protein crystallization for structural determination, as demonstrated with other Geobacillus proteins like 6-phosphogluconate dehydrogenase (Gs6PDH) .

  • Resistance to extreme conditions: Thermostable proteins maintain activity under conditions that would denature mesophilic counterparts, allowing experiments at higher temperatures or in the presence of denaturants or organic solvents .

For example, recombinant manganese-catalase (Cat-II Gt) from the thermophilic bacterium Geobacillus thermopakistaniensis exhibits remarkable thermostability with a half-life of 30 minutes at 100°C and optimal activity at pH 10.0 and 70°C .

What experimental approaches are most effective for investigating the gating mechanism of recombinant Geobacillus sp. mscL?

Several complementary experimental approaches have proven effective for investigating the gating mechanism of mscL channels:

  • Patch-clamp electrophysiology: The gold standard for functional characterization of mechanosensitive channels. For mscL, this involves:

    • Giant spheroplast or liposome patch preparations

    • Application of negative pressure (suction) to generate membrane tension

    • Recording channel conductance (typically 3.6 nS for mscL)

    • Analysis of gating kinetics, including dwell times in open and closed states

  • Fluorescence-based approaches:

    • FRET (Förster Resonance Energy Transfer) to monitor conformational changes during gating

    • Single-molecule FRET to capture intermediate states

    • Site-specific labeling of cysteine mutants with fluorescent probes to track movement of specific protein regions

  • Molecular dynamics simulations:

    • All-atom simulations to model channel responses to membrane tension

    • Coarse-grained simulations to explore longer timescales

    • Integration with experimental data to validate mechanistic models

  • Site-directed mutagenesis coupled with functional assays:

    • Systematic mutation of key residues (particularly at the N-h-h-D motif and hydrophobic gate)

    • Correlation of mutations with changes in channel gating parameters

    • In vivo complementation assays using osmotic downshock survival

  • In vitro reconstitution systems:

    • Reconstitution of purified mscL into liposomes of defined lipid composition

    • Examination of lipid-protein interactions using EPR spectroscopy

    • Investigation of the "force-from-lipid" (FFL) hypothesis that suggests mscL senses tension transmitted through the lipid bilayer rather than through cytoskeletal tethers

Recent studies with mscL have shown that the channel can be activated by amphipaths and lipid-like molecules that add stresses to the membrane, supporting the FFL hypothesis. Comprehensive studies have determined that tension in the membrane, rather than pressure across it or curvature within it, is the primary stimulus for mscL gating .

How can researchers investigate structure-function relationships in thermostable mscL channels?

Investigating structure-function relationships in thermostable mscL channels requires multidisciplinary approaches:

  • Comparative genomics and sequence analysis:

    • Multiple sequence alignment of mscL proteins from mesophilic and thermophilic species (e.g., E. coli vs. Geobacillus sp.)

    • Identification of conserved domains and thermophile-specific motifs

    • Phylogenetic analysis to trace evolutionary relationships

  • Structure determination methods:

    • X-ray crystallography of the purified protein in different conformational states

    • Cryo-electron microscopy (cryo-EM) to capture the channel in native-like membrane environments

    • NMR spectroscopy for dynamics studies

  • Chimeric protein analysis:

    • Creation of chimeric channels where domains are exchanged between thermophilic and mesophilic homologs

    • Functional characterization to identify regions responsible for thermostability versus function

    • Assessment of gating properties using patch-clamp electrophysiology

  • Directed evolution and rational design:

    • Creation of libraries with random or site-directed mutations

    • Screening for variants with altered thermostability while maintaining function

    • Iterative improvement through multiple rounds of selection

  • Molecular dynamics simulations at different temperatures:

    • Comparison of protein dynamics at elevated versus ambient temperatures

    • Identification of structural elements that contribute to thermostability

    • Investigation of water networks and ion hydration differences

  • Differential scanning calorimetry (DSC) and circular dichroism (CD):

    • Determination of thermal denaturation profiles

    • Measurement of transition temperatures and enthalpies

    • Assessment of secondary structure stability at different temperatures

  • In vitro reconstitution in liposomes with varying lipid compositions:

    • Investigation of lipid-protein interactions at different temperatures

    • Assessment of channel function in membranes with different physical properties

    • Exploration of the interplay between membrane fluidity and channel gating at elevated temperatures

What methodologies are most reliable for expressing and reconstituting functional Geobacillus sp. mscL for biophysical studies?

Reliable methodologies for expressing and reconstituting functional Geobacillus sp. mscL include:

  • Optimized heterologous expression systems:

    • Use of specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression

    • Codon optimization of the Geobacillus sp. mscL gene for E. coli expression

    • Temperature-controlled expression (typically 18-30°C) to balance protein production and proper folding

    • Induction with low IPTG concentrations (0.1-0.4 mM) to prevent inclusion body formation

    • Use of fusion partners like MBP or SUMO to enhance solubility

  • Effective membrane protein extraction:

    • Gentle cell lysis methods like French press at 10,000-20,000 psi or sonication with cooling intervals

    • Use of detergent screens to identify optimal solubilization conditions

    • Common effective detergents include n-Dodecyl β-D-maltoside (DDM), n-Octyl β-D-glucopyranoside (OG), or digitonin

    • Two-step extraction beginning with milder detergents followed by more stringent ones

  • Purification strategies preserving native conformation:

    • IMAC purification using cobalt rather than nickel resins for more specific binding

    • Size exclusion chromatography in detergent micelles to remove aggregates

    • Affinity tag removal using specific proteases (TEV, PreScission) when tags interfere with function

    • Quality control by SEC-MALS to confirm homogeneity and oligomeric state

  • Reconstitution into model membrane systems:

    • Liposome reconstitution via detergent removal methods:

      • Dialysis (slow but gentle)

      • Bio-Beads adsorption (faster but requires optimization)

      • Dilution below critical micelle concentration (CMC)

    • Lipid composition optimization:

      • E. coli polar lipid extracts to mimic native environment

      • Defined synthetic mixtures (POPC/POPE/POPG) for controlled experiments

      • Incorporation of native Geobacillus lipids when available

    • Protein-to-lipid ratios typically between 1:100 and 1:2000 (w/w)

  • Functional validation methods:

    • Patch-clamp analysis of reconstituted proteoliposomes

    • Fluorescence-based flux assays using self-quenching dyes (calcein, ANTS/DPX)

    • EPR spectroscopy with site-specifically labeled channels to confirm conformational changes

    • Stopped-flow measurements to capture rapid gating kinetics

  • Long-term stability enhancement:

    • Addition of specific lipids like phosphatidylinositol that stabilize certain mscL homologs

    • Use of disaccharides (trehalose, sucrose) as cryoprotectants

    • Supplementation with kosmotropic agents to stabilize native state

How can researchers exploit Geobacillus sp. mscL for biotechnological applications such as controlled release systems?

Researchers can exploit Geobacillus sp. mscL for biotechnological applications through several innovative approaches:

  • Engineered stimuli-responsive nanovalves:

    • Site-directed mutagenesis to create mscL variants responsive to specific triggers

    • Introduction of cysteine residues at strategic positions for chemical modification

    • Engineering of pH-sensitive, light-activated, or temperature-responsive gating

  • Drug delivery systems:

    • Incorporation of mscL into liposomal drug carriers

    • Loading of therapeutic compounds into liposomes containing engineered mscL

    • Triggered release via controlled application of mechanical, chemical, or physical stimuli

    • Exploitation of the large pore size (up to 30 Å) for delivery of macromolecules

  • Biosensing platforms:

    • Development of membrane tension sensors based on mscL gating

    • Creation of reporting systems where channel opening is coupled to detectable signals

    • Integration with electrical or optical detection methods for real-time monitoring

  • Antibiotic delivery enhancement:

    • Leveraging the finding that streptomycin uses mscL as a primary path to the cytoplasm

    • Development of combination therapies exploiting mscL-dependent uptake mechanisms

    • Design of compounds that enhance antimicrobial efficacy through mscL modulation

  • High-throughput screening platforms:

    • Creation of cell-based assays to identify novel mscL modulators

    • Development of in vitro systems for screening compound libraries

    • Application to drug discovery for mechanosensitive channel-related conditions

  • Thermostable biocatalytic nanoreactors:

    • Encapsulation of enzymes in liposomes with regulated access via mscL

    • Controlled substrate entry and product release through triggered channel opening

    • Exploitation of Geobacillus sp. mscL thermostability for high-temperature biocatalysis

  • Mechanosensitive bioelectronic interfaces:

    • Integration of mscL-containing membranes with electronic components

    • Development of pressure-sensing bioelectronic devices

    • Creation of interfaces between biological and electronic systems

The thermostability of Geobacillus sp. mscL provides additional advantages for these applications, including enhanced storage stability, resistance to harsh conditions, and compatibility with high-temperature processes.

How do the properties of Geobacillus sp. mscL compare with those from mesophilic bacterial species like E. coli?

The properties of Geobacillus sp. mscL differ from those of mesophilic bacteria like E. coli in several important aspects:

Sequence and Structural Comparison

FeatureGeobacillus sp. mscLE. coli mscLNotes
Sequence length131 amino acids136 amino acidsGeobacillus has a slightly shorter sequence
Sequence identityReference~70-80%Moderate conservation, primarily in transmembrane regions
Hydrophobic gatePresentPresentCore gating mechanism conserved
N-terminal domainMore compactSlightly longerMay influence channel kinetics
C-terminal domainContains thermostabilizing residuesLess stableImportant for oligomerization and stability

Functional Properties

PropertyGeobacillus sp. mscLE. coli mscLNotes
Temperature optimum50-70°C30-37°CReflects native growth conditions
Gating thresholdMay be higherLowerThermophiles often have more rigid membranes requiring higher tension
ConductanceSimilar to E. coli (~3-4 nS)~3.6 nSConserved large conductance feature
KineticsOften faster closingSlower closingThermostable proteins typically exhibit faster dynamics
pH stabilityBroader range (pH 5-10)Narrower range (pH 6-8)Thermophilic proteins often show broader pH stability

Biophysical Properties

PropertyGeobacillus sp. mscLE. coli mscLNotes
ThermostabilityStable up to 80-90°CDenatures above 50°CMajor advantage of Geobacillus proteins
Detergent stabilityHigherLowerBetter retention of native structure in detergents
Reconstitution efficiencyOften higherVariableMay fold more efficiently in membrane mimetics
Lipid requirementsLess stringentMore specificE. coli mscL function depends more on specific lipids
Resistance to denaturantsHigherLowerEnhanced stability in urea, guanidinium chloride

Experimental Considerations

ConsiderationGeobacillus sp. mscLE. coli mscLNotes
Expression yieldOften higherVariableThermostable proteins often express better
Purification stabilityHigherLowerBetter retention of structure during handling
Crystallization propensityOften higherLowerMore rigid structure facilitates crystal formation
Patch-clamp temperatureCan be studied at higher temperaturesLimited to lower temperaturesAllows investigation of temperature effects on gating
Model membrane compatibilityWorks in diverse lipid environmentsMore selectiveGreater experimental flexibility

The enhanced thermal and chemical stability of Geobacillus sp. mscL makes it an attractive alternative to E. coli mscL for structural studies, biotechnological applications, and investigations under harsh conditions, while still maintaining the core mechanosensitive properties that define this channel family.

What are the current methodological approaches for modifying mscL to create engineered nanovalves for controlled release applications?

Current methodological approaches for modifying mscL to create engineered nanovalves include:

  • Site-directed mutagenesis for altered gating properties:

    • Mutation of hydrophobic pore residues to charged or polar amino acids to decrease the energy barrier for opening

    • Introduction of mutations at the G22 position (in E. coli numbering), which shifts the tension threshold for gating

    • Creation of constitutively open mutants through strategic destabilization of the closed conformation

    • Engineering of tension-insensitive channels that respond to alternative stimuli

  • Chemical modification strategies:

    • Introduction of cysteine residues at strategic positions (particularly at the pore constriction)

    • Site-specific labeling with:

      • pH-sensitive chemical groups that change conformation with pH

      • Photocleavable moieties for light-controlled activation

      • Charged groups that create electrostatic repulsion within the pore

    • Use of bifunctional crosslinkers to control subunit interactions

  • Charge-based modifications:

    • Engineering of charged rings within the pore to create electrostatic barriers

    • pH-dependent charge alterations that trigger gating at specific pH values

    • Introduction of charged amino acids that bind specific ions, creating ion-sensitive gates

  • Lipid-protein interaction engineering:

    • Modification of the lipid-facing residues to alter membrane tension sensitivity

    • Engineering of specific lipid binding sites that modulate channel activity

    • Exploitation of lipid-protein interactions to create environment-responsive channels

  • Nanodisc and liposome incorporation methods:

    • Development of protocols for oriented incorporation into synthetic membranes

    • Control of protein density to ensure optimal function

    • Creation of asymmetric membranes to direct channel orientation

    • Methods for stable long-term storage of functional proteoliposomes

  • Thermostability engineering:

    • Introduction of stabilizing mutations from thermophilic homologs into mesophilic channels

    • Disulfide bond engineering to enhance stability while maintaining stimulus responsiveness

    • Rational design guided by molecular dynamics simulations to identify stabilizing interactions

  • Multimodal triggering systems:

    • Development of channels responsive to multiple orthogonal stimuli (e.g., tension AND pH)

    • Creation of logical gate-like behavior where multiple conditions must be met for opening

    • Engineering of channels with programmable response thresholds

  • High-throughput screening platforms:

    • Development of fluorescence-based assays to rapidly screen libraries of mscL variants

    • In vivo selection systems to identify channels with desired properties

    • Microfluidic platforms for single-channel characterization of multiple variants

These approaches collectively enable the development of precision-engineered mscL nanovalves with tailored properties for specific applications in drug delivery, biosensing, and synthetic biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.