Recombinant Geobacillus sp. NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Geobacillus sp. NADH-Quinone Oxidoreductase Subunit K (nuoK)

Recombinant Geobacillus sp. NADH-quinone oxidoreductase subunit K (nuoK) is a bacterial membrane protein component of the proton-pumping NADH:ubiquinone oxidoreductase complex (Complex I), critical for electron transport and energy transduction in aerobic respiration. This enzyme catalyzes the transfer of electrons from NADH to ubiquinone, coupled with proton translocation across the membrane to generate a proton motive force (PMF) for ATP synthesis . The recombinant form is expressed in Escherichia coli systems with affinity tags for purification, enabling structural and functional studies .

Protein Composition

  • Primary Structure: The full-length subunit K from Geobacillus sp. strain WCH70 comprises 104 amino acids (UniProt ID: C5D981), with a conserved sequence critical for membrane anchoring and quinone binding .
    Sequence:
    MSSVPLSVYLVLALILFCIGLYGALTKRNTVIVLICIELMLNAVNINLVAFAKYGAHPGIAGQIFALFTITVAAAEAAVGLAILMALYRNRKTVHIDEIDSMKH .

  • Domains: Belongs to the Complex I subunit 4L family, featuring transmembrane helices essential for quinone reduction and proton channeling .

PropertyDetails
Molecular Weight~11.2 kDa (theoretical)
Isoelectric Point (pI)Predicted 9.5–10.0 (alkaline, membrane-associated)
TagN-terminal His-tag (enhances solubility and purification)
Purity>90% (SDS-PAGE)

Expression Systems

  • Host: E. coli (BL21 or similar strains) .

  • Vector: Plasmid-based systems optimized for high-yield cytoplasmic expression .

Purification Protocol

  1. Lysis: Cells disrupted via sonication in Tris/PBS buffer (pH 8.0) .

  2. Affinity Chromatography: Ni-NTA resin binds His-tagged nuoK .

  3. Buffer Exchange: Stabilized in 6% trehalose or 50% glycerol to prevent aggregation .

Catalytic Mechanism

  • Electron Transfer: Accepts electrons from NADH via FMN and iron-sulfur clusters, transferring them to ubiquinone .

  • Proton Translocation: Transports 4 H⁺ ions per 2 electrons, contributing to PMF generation .

Inhibitor Sensitivity

  • Rotenone/Piericidin: Blocks quinone binding, abolishing activity .

  • Thermostability: Retains function at temperatures up to 60°C (adaptation to Geobacillus thermophily) .

Drug Development

  • Antimicrobial Targets: Explored for designing inhibitors against pathogenic bacteria reliant on NADH-quinone oxidoreductase .

Metabolic Engineering

  • Bioenergetics: Engineered into synthetic electron transport chains for enhanced ATP yield in industrial microbes .

Comparative Analysis of Recombinant nuoK Variants

SourceGeobacillus sp. WCH70 E. coli O1:K1 Bacillus thuringiensis
Expression HostE. coliE. coliE. coli
TagHis-tagHis-tagUndisclosed
Length104 aa100 aaPartial (specific region)
Purity>90%>85%>85%

Key Challenges and Future Directions

  • Crystallization Difficulty: Hydrophobic transmembrane domains hinder crystallization .

  • Functional Redundancy: Overlapping roles with other Complex I subunits require knockout studies for validation .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Important: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
nuoK; GWCH70_3294; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Geobacillus sp. (strain WCH70)
Target Names
nuoK
Target Protein Sequence
MSSVPLSVYLVLALILFCIGLYGALTKRNTVIVLICIELMLNAVNINLVAFAKYGAHPGI AGQIFALFTITVAAAEAAVGLAILMALYRNRKTVHIDEIDSMKH
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. The immediate electron acceptor for this enzyme in the species is believed to be a menaquinone. This process couples the redox reaction to proton translocation, resulting in four hydrogen ions being translocated across the cytoplasmic membrane for every two electrons transferred. This mechanism effectively conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K (nuoK) in Geobacillus species?

NADH-quinone oxidoreductase subunit K (nuoK) is a critical membrane-bound component of respiratory Complex I in Geobacillus species. This subunit contributes to the proton-pumping function of the enzyme complex and plays an essential role in the electron transport chain of these thermophilic bacteria. In Geobacillus, which are moderate thermophiles growing optimally at 45-70°C, nuoK maintains structural integrity at elevated temperatures while participating in energy conservation through the generation of proton motive force across the membrane. The protein is characterized by its highly hydrophobic nature, containing multiple transmembrane helices that anchor it within the bacterial membrane.

Why use Geobacillus species for recombinant nuoK expression?

Geobacillus species offer several distinct advantages for recombinant expression of thermostable proteins like nuoK. These thermophilic bacteria provide a native-like environment for proper folding and membrane insertion of thermostable membrane proteins. Specifically, Geobacillus cellular machinery is adapted to function at elevated temperatures, which can facilitate proper expression of proteins that might misfold or aggregate in mesophilic expression systems. Additionally, the theta-replication mechanism in Geobacillus shuttle vectors provides enhanced plasmid structural stability, which is advantageous for maintaining consistent expression levels over multiple generations . The moderate thermophilic nature also reduces contamination risks during large-scale cultivation while potentially improving solubility and reducing proteolytic degradation of recombinant proteins.

What expression vectors are recommended for recombinant nuoK in Geobacillus?

For recombinant nuoK expression in Geobacillus, the pUCG18 shuttle vector system is highly recommended. This vector offers several key advantages specifically designed for Geobacillus expression:

  • Modest size (6331 bp) that allows for good transformation frequencies

  • Blue-white screening capability for insert detection in E. coli

  • Kanamycin resistance as a selection marker, which is particularly valuable as kanamycin is the most thermally-resistant of common antibiotics

  • Theta-replication mechanism in Geobacillus, which enhances plasmid structural stability

When working with membrane proteins like nuoK, consider using this vector with a strong, inducible promoter suitable for Geobacillus (such as modified versions of PgroE or Pspac), along with an appropriate signal sequence to facilitate membrane targeting.

How does temperature affect the expression and activity of recombinant nuoK?

Temperature significantly impacts both the expression and enzymatic activity of recombinant nuoK from Geobacillus. Expression typically reaches optimal levels at temperatures between 55-60°C, which reflects the thermophilic nature of Geobacillus species. At these elevated temperatures, proper folding and membrane insertion are facilitated due to increased membrane fluidity and compatibility with the thermophilic cellular machinery.

Regarding enzymatic activity, recombinant nuoK exhibits a temperature-activity profile that typically shows:

  • Minimal activity below 40°C

  • Rapid increase in activity between 45-55°C

  • Optimal activity around 55-65°C

  • Gradual decline in activity above 70°C

This temperature dependence stems from the evolutionary adaptation of Geobacillus proteins to function optimally at elevated temperatures. The thermostability of nuoK is attributed to specific structural features including increased ionic interactions, hydrophobic packing, and reduced surface loop flexibility compared to mesophilic homologs.

What strategies can overcome the challenges of membrane protein overexpression in Geobacillus?

Membrane protein overexpression in Geobacillus species presents several unique challenges that require specific strategies to overcome:

  • Codon optimization: Adapt the nuoK coding sequence to Geobacillus codon usage preference to enhance translation efficiency. Interestingly, research has shown that sometimes cross-species codon optimization can yield unexpected benefits. For example, Overkamp et al. found that GFP variants optimized for Streptococcus pneumoniae produced stronger signals in Bacillus subtilis, while variants optimized for B. subtilis performed better in S. pneumoniae .

  • Fusion tags selection: For thermophilic expression, use thermostable tags such as:

    • Modified His6-tags with additional stabilizing residues

    • ThermoTag (engineered thermostable variant of common affinity tags)

    • Thermostable fluorescent proteins like evoglow for real-time expression monitoring

  • Expression regulation: Implement a dual-control expression system with:

    • Temperature-inducible promoters that activate at specific temperature thresholds

    • Chemical induction systems modified to function at elevated temperatures

    • Carefully timed induction protocols to align with optimal growth phase

  • Membrane homeostasis maintenance: Supplement growth media with specific lipids that support membrane integrity at elevated temperatures and incorporate membrane-stabilizing compounds to prevent toxicity from membrane protein accumulation.

  • Chaperone co-expression: Co-express thermostable chaperones specific to Geobacillus to facilitate proper folding of complex membrane proteins.

These strategies should be implemented in combination rather than isolation, with careful optimization for the specific nuoK variant being expressed.

How can you distinguish between properly folded and misfolded recombinant nuoK?

Distinguishing between properly folded and misfolded recombinant nuoK requires a multi-faceted analytical approach:

  • Functional assays: Measure NADH oxidation rates and proton pumping efficiency. Properly folded nuoK incorporated into the respiratory complex will demonstrate coupling between electron transfer and proton translocation, while misfolded variants will show uncoupled or significantly reduced activity.

  • Structural integrity analysis:

    • Circular dichroism (CD) spectroscopy at elevated temperatures (45-65°C) to assess secondary structure content

    • Limited proteolysis patterns (properly folded proteins show distinct protease-resistant fragments)

    • Differential scanning calorimetry to determine thermal transition points

  • Membrane integration assessment:

    • Detergent extraction profiles (properly folded membrane proteins require specific detergent conditions)

    • Fluorescence resonance energy transfer (FRET) assays with lipid probes

    • Sucrose gradient ultracentrifugation to verify association with membrane fractions

  • Oligomeric state verification:

    • Blue native PAGE to analyze native complex formation

    • Size exclusion chromatography combined with multi-angle light scattering

    • Chemical crosslinking followed by mass spectrometry

When applying these techniques to thermophilic proteins like nuoK from Geobacillus, all analytical procedures must be conducted at appropriate elevated temperatures to maintain native-like conditions throughout the analysis.

What is the mechanism of substrate binding and electron transfer in Geobacillus nuoK compared to mesophilic homologs?

The mechanism of substrate binding and electron transfer in Geobacillus nuoK shows distinctive thermoadaptive features compared to mesophilic homologs:

  • Substrate binding characteristics:

    • Increased hydrophobic interactions at the binding interface that strengthen at elevated temperatures

    • Reduced conformational flexibility at the binding site, maintaining optimal geometry across a wider temperature range

    • Modified charge distribution that accommodates changes in substrate pKa values at higher temperatures

  • Electron transfer pathway:

    • Enhanced electronic coupling between redox centers through optimized distances between electron carriers

    • Thermostable iron-sulfur clusters with additional coordinating residues

    • Reduced reorganization energy requirements for electron transfer steps

  • Comparative kinetic parameters:

    • Typically exhibits higher Km values at standard temperatures (25°C) but comparable or lower Km values at elevated temperatures (55-65°C)

    • Demonstrates sequential random binding mechanism similar to other enzymes from thermophilic Bacillus species, but with thermally optimized rate constants

    • Shows distinctive substrate inhibition patterns at non-physiological temperatures

This mechanism reflects evolutionary adaptation to maintain efficient energy conservation under thermophilic conditions, balancing structural rigidity for thermostability with sufficient flexibility for catalytic function.

What purification protocol is most effective for recombinant nuoK from Geobacillus?

The most effective purification protocol for recombinant nuoK from Geobacillus requires a specialized approach that accounts for both its membrane-bound nature and thermostability:

  • Cell disruption and membrane isolation:

    • High-temperature growth (55-60°C) followed by harvest at late exponential phase

    • Cell disruption via sonication or high-pressure homogenization in buffer containing 50 mM Tris-HCl (pH 8.0 at 55°C), 150 mM NaCl, 10% glycerol, and protease inhibitors

    • Differential centrifugation to isolate membrane fraction (45,000 × g for 1 hour)

  • Membrane protein solubilization:

    • Solubilization using mild detergents like n-dodecyl-β-D-maltoside (DDM) at 0.5-1% concentration

    • Incubation at 50°C for 1 hour with gentle agitation

    • Centrifugation at 100,000 × g for 1 hour to remove insoluble material

  • Thermally-assisted purification (TAP):

    • Heat treatment step (65°C for 15 minutes) to precipitate heat-labile contaminants

    • Affinity chromatography using thermostable matrices (e.g., ceramic hydroxyapatite)

    • Size exclusion chromatography with detergent-containing buffers at elevated temperatures

  • Quality assessment:

    • SDS-PAGE analysis with thermostable protein markers

    • Western blotting using antibodies against the recombinant tag or nuoK

    • Activity assays to confirm functional integrity

This protocol typically yields 0.5-1.5 mg of purified nuoK per liter of Geobacillus culture with >85% purity and preserved functional activity.

How can you optimize protein yield and stability for structural studies of nuoK?

Optimizing protein yield and stability for structural studies of nuoK from Geobacillus requires a systematic approach addressing multiple factors:

  • Expression optimization:

    • Fine-tune induction parameters (temperature, inducer concentration, timing)

    • Implement fed-batch cultivation with controlled dissolved oxygen levels

    • Co-express specific thermostable chaperones to enhance proper folding

  • Stabilization during purification:

    • Screen detergent combinations using thermal shift assays

    • Incorporate lipids that mimic the native Geobacillus membrane environment

    • Add specific stabilizers like trimethylamine N-oxide (TMAO) or specific ions (e.g., Mg2+, Mn2+)

  • Buffer optimization matrix:

    Buffer ComponentRange to TestOptimal for nuoK
    pH6.5-8.57.8-8.2 at 55°C
    Salt (NaCl)100-500 mM200-250 mM
    Glycerol5-20%12-15%
    DetergentDDM, LMNG, GDNDDM/CHS mixture
    AdditivesVarious lipids, cholesterolE. coli polar lipids
  • Cryoprotection strategies:

    • Flash-freezing in liquid nitrogen after addition of 20-25% glycerol

    • Addition of sucrose (5-10%) combined with trehalose (5%) for lyophilization

    • Storage at -80°C with oxygen-scavenging compounds to prevent oxidative damage

  • Structural stabilization:

    • Introduction of engineered disulfide bonds at strategic positions

    • Ligand or inhibitor co-purification to stabilize specific conformations

    • Application of multistate design approaches to engineer thermostable variants

Implementation of these strategies has been shown to increase functional protein yields by 3-5 fold and extend protein stability at room temperature from hours to several weeks.

What analytical methods best characterize the proton-pumping activity of recombinant nuoK?

The proton-pumping activity of recombinant nuoK can be most effectively characterized through complementary analytical approaches that capture both direct and indirect measurements:

  • Reconstitution systems:

    • Proteoliposome reconstitution with defined lipid compositions

    • Purified respiratory chain component incorporation in appropriate stoichiometry

    • Creation of inverted membrane vesicles from Geobacillus expressing recombinant nuoK

  • Direct proton translocation measurements:

    • pH-sensitive fluorescent dyes (ACMA, pyranine) entrapped in proteoliposomes

    • Stopped-flow spectroscopy to capture rapid kinetics of proton movement

    • Microelectrode systems with temperature-controlled chambers

  • Coupled activity assays:

    • NADH oxidation rates measured spectrophotometrically at 340 nm

    • Oxygen consumption measured using high-temperature Clark electrodes

    • Membrane potential generation using voltage-sensitive fluorescent probes

  • Advanced biophysical techniques:

    • Electrophysiology measurements using solid-supported membrane technology

    • Hydrogen/deuterium exchange mass spectrometry to identify proton transfer pathways

    • Time-resolved FTIR difference spectroscopy to detect protonation state changes

These methods should be implemented at physiologically relevant temperatures (55-65°C) for Geobacillus nuoK to obtain meaningful data, with appropriate controls to distinguish specific nuoK-mediated proton pumping from other effects.

How can researchers differentiate between experimental artifacts and genuine results when studying recombinant nuoK?

Differentiating between experimental artifacts and genuine results when studying recombinant nuoK requires rigorous controls and validation strategies:

  • Control experiments design:

    • Inactive mutant controls (site-directed mutagenesis of key residues)

    • Empty vector controls processed identically to nuoK-containing samples

    • Measurement of background activities in membrane preparations lacking recombinant nuoK

    • Temperature-dependent measurements to identify thermal artifacts

  • Validation across multiple techniques:

    • Confirm key findings using at least two independent methodological approaches

    • Apply both in vitro (purified protein) and in vivo (whole cell) assays

    • Correlate functional measurements with structural or binding data

  • Statistical analysis frameworks:

    • Apply appropriate statistical tests for significance assessment

    • Implement outlier detection algorithms specifically designed for thermophilic enzyme kinetics

    • Utilize regression analysis to identify and correct for temperature-dependent background effects

  • Common artifact identification:

    Artifact TypeCharacteristicsMitigation Strategy
    Detergent-induced activityActivity changes with detergent concentrationDetergent titration curves, native membrane controls
    Thermal denaturation effectsTime-dependent activity decreaseTime-course measurements, thermal stability controls
    Non-specific membrane effectsActivity in control membranesIon selectivity tests, inhibitor specificity
    Aggregation artifactsSize-dependent activity variationsDLS monitoring, SEC-MALS analysis
  • Data validation through modeling:

    • Develop kinetic models incorporating thermodynamic parameters

    • Compare experimental data with predicted behavior based on molecular dynamics simulations

    • Apply population-based statistical approaches similar to those used in genome-wide association studies

These strategies collectively minimize the risk of misinterpreting artifacts as genuine biological phenomena and enhance the reproducibility of nuoK research findings.

What bioinformatic approaches help predict structure-function relationships in thermophilic nuoK variants?

Advanced bioinformatic approaches provide valuable insights into structure-function relationships in thermophilic nuoK variants:

  • Comparative sequence analysis:

    • Multiple sequence alignment of nuoK homologs across thermophilic, mesophilic, and psychrophilic organisms

    • Analysis of conservation patterns in transmembrane regions versus loop regions

    • Identification of thermophile-specific sequence motifs and amino acid bias

  • Structural modeling approaches:

    • Homology modeling using cryo-EM structures of respiratory complex I as templates

    • Molecular dynamics simulations at elevated temperatures (55-65°C)

    • Energy minimization calculations incorporating membrane environment

  • Machine learning implementation:

    • Neural network prediction of thermal stability based on primary sequence

    • Random forest algorithms to identify residue combinations contributing to thermostability

    • Support vector machines to classify functional variants

  • Network analysis:

    • Coevolution analysis to identify residue networks essential for thermostability

    • Protein contact network assessment to identify critical nodes for structural integrity

    • Perturbation analysis to predict effects of mutations on protein dynamics

  • Integrative multi-omics approaches:

    • Correlation of genomic, transcriptomic, and proteomic data from thermophilic organisms

    • Application of genome-wide association study methodologies to identify genetic variants associated with thermal adaptation

    • Pathway analysis to contextualize nuoK within the broader bioenergetic network of thermophiles

These computational approaches provide testable hypotheses for experimental validation and guide rational protein engineering efforts to enhance specific properties of nuoK for research or biotechnological applications.

How should researchers interpret conflicting data between in vitro and in vivo studies of nuoK function?

When faced with conflicting data between in vitro and in vivo studies of nuoK function, researchers should implement a systematic reconciliation framework:

  • Contextual differences analysis:

    • Evaluate membrane composition differences between purified systems and native environments

    • Consider the impact of cellular ion concentrations and pH on nuoK function

    • Assess the influence of respiratory complex supercomplex formation in vivo

  • Methodological limitations assessment:

    • Identify detergent effects that may alter protein conformation in vitro

    • Consider artifactual proton leakage in reconstituted systems

    • Evaluate whether in vivo measurements capture indirect effects from other cellular processes

  • Resolution strategies:

    • Implement intermediate experimental systems (e.g., inverted membrane vesicles, spheroplasts)

    • Develop genetic complementation tests with specific nuoK variants

    • Apply isotope labeling strategies to track proton movement specifically through nuoK

  • Unified model development:

    • Construct mathematical models incorporating parameters from both in vitro and in vivo experiments

    • Design experiments specifically to test predictions from these unified models

    • Implement multi-state design approaches that account for different environmental conditions

  • Hierarchical data integration:

    Data TypeReliability HierarchyIntegration Approach
    Direct enzymatic assaysHigh for specific activity, lower for physiological relevanceBaseline for kinetic parameters
    Proteoliposome studiesMedium-high for direct function, affected by reconstitutionBridge between purified and cellular systems
    Cell-based measurementsHigh for physiological relevance, lower for mechanistic detailFramework for contextualizing molecular data
    Computational predictionsVariable based on input data qualityHypothesis generation and data interpretation

This systematic approach acknowledges that differences between in vitro and in vivo data often reflect biological reality rather than experimental error, with each providing valuable but complementary information about nuoK function.

What are the future research directions for recombinant Geobacillus nuoK studies?

Future research directions for recombinant Geobacillus nuoK studies will likely focus on several promising avenues:

These research directions will be facilitated by continued improvement in genetic tools for Geobacillus, including the refinement of expression vectors like pUCG18 and the development of more sophisticated genetic manipulation techniques adapted for thermophilic organisms.

How can contradictory findings about nuoK function be reconciled in the scientific literature?

Reconciling contradictory findings about nuoK function in the scientific literature requires a multi-faceted approach that acknowledges various sources of experimental variability:

  • Standardization initiatives:

    • Development of consensus protocols for nuoK expression and purification

    • Establishment of reference Geobacillus strains for comparative studies

    • Creation of standardized assay conditions that account for temperature-dependent variables

  • Meta-analysis frameworks:

    • Systematic reviews of methodological differences between contradictory studies

    • Statistical integration of data across multiple studies with weighting based on methodological rigor

    • Implementation of Bayesian approaches to update confidence in specific models based on accumulating evidence

  • Collaborative verification:

    • Multi-laboratory testing of key findings with standardized materials

    • Development of shared resources like validated antibodies and calibrated activity assays

    • Implementation of round-robin testing for critical measurements

  • Integrated mechanistic models:

    • Development of comprehensive models that can accommodate apparently contradictory data

    • Identification of experimental conditions that might explain divergent results

    • Application of multi-state design approaches to understand how nuoK might function differently under various conditions

  • Technological resolution:

    • Application of emerging technologies to resolve longstanding controversies

    • Re-examination of key experiments using improvements in protein science

    • Integration of data from multiple experimental modalities to develop unified explanations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.