Recombinant Geobacillus sp. UPF0344 protein GWCH70_0687 (GWCH70_0687)

What is the basic structure and composition of Geobacillus sp. UPF0344 protein GWCH70_0687?

Geobacillus sp. UPF0344 protein GWCH70_0687 is a full-length protein comprising 117 amino acids. The complete amino acid sequence is: "MTHAHITSWLITVILFFIAVSLQRSGASKAKIVQMALRLFYIFTVITGGLLLHSIASISILYIIKAIVGLWLIGAMEMVLSGMKKGKNTNVAWIQWIVAFVLVLFLGFMLPLGFDLF" . The protein is classified as part of the UPF0344 family, which contains proteins of unknown function. Analysis of the amino acid sequence suggests the protein may contain transmembrane domains, based on the presence of hydrophobic stretches of amino acids.

What are the optimal storage conditions for maintaining protein stability?

For long-term storage, maintain the recombinant protein at -20°C/-80°C in aliquots to minimize freeze-thaw cycles which can compromise protein integrity . The commercially available protein is typically provided as a lyophilized powder in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . Working aliquots can be stored at 4°C for up to one week. For optimal results, it is recommended to centrifuge the vial briefly before opening to bring contents to the bottom, particularly when working with lyophilized preparations .

What is the recommended reconstitution protocol for lyophilized GWCH70_0687?

The recommended reconstitution procedure involves dissolving the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage of reconstituted protein, it is advisable to add glycerol to a final concentration of 5-50% (standard is 50%) and aliquot before storing at -20°C/-80°C . This prevents protein degradation and maintains stability through multiple experimental uses. Always ensure sterile technique during reconstitution to prevent contamination.

What expression systems are most effective for GWCH70_0687 production?

The recombinant GWCH70_0687 protein is commonly expressed in E. coli expression systems . The protein is typically fused to an N-terminal His tag to facilitate purification . While E. coli is the predominant system, alternative expression hosts including yeast, baculovirus, and mammalian cell systems can also be employed depending on experimental requirements . The choice of expression system should consider factors such as post-translational modifications, protein folding requirements, and downstream applications. For structural studies requiring native conformation, insect or mammalian expression systems may offer advantages over bacterial systems.

What purification strategy yields the highest purity for GWCH70_0687?

The standard purification protocol leverages affinity chromatography targeting the N-terminal His tag fusion . This approach typically yields protein preparations with greater than 90% purity as determined by SDS-PAGE . For enhanced purity, a multi-step purification protocol can be implemented, incorporating:

• Initial IMAC (Immobilized Metal Affinity Chromatography) purification

• Buffer exchange to remove imidazole

• Secondary ion-exchange chromatography

• Size exclusion chromatography as a polishing step

The choice of purification strategy should be guided by the intended downstream application, with more stringent purification necessary for structural studies or sensitive functional assays.

What experimental approaches can determine the function of this hypothetical protein?

As a member of the UPF0344 family designated as a "hypothetical protein" , determining the function of GWCH70_0687 requires a multi-faceted approach:

Integration of these approaches provides complementary evidence needed to establish the function of previously uncharacterized proteins like GWCH70_0687.

How does the membrane topology of GWCH70_0687 influence experimental design?

Analysis of the amino acid sequence reveals hydrophobic regions consistent with transmembrane domains . This membrane-associated nature significantly impacts experimental design. When designing functional assays, researchers should:

• Consider detergent solubilization protocols compatible with membrane proteins

• Evaluate reconstitution into liposomes or nanodiscs for functional studies

• Implement topology mapping using protease accessibility or fluorescence techniques

• Design constructs that maintain native membrane insertion during heterologous expression

• Consider cell-free expression systems with supplied lipids for direct incorporation into membranes

The hypothesized membrane association suggests potential roles in transport, signaling, or membrane integrity that should guide functional hypothesis testing.

How conserved is GWCH70_0687 across different bacterial species?

The UPF0344 protein family is found across multiple bacterial genera including Geobacillus, Bacillus, Staphylococcus, and Listeria . Comparative analysis reveals:

This conservation pattern suggests evolutionary importance and potentially conserved function, with higher conservation within thermophilic genera. Phylogenetic analysis of sequence relationships can provide insights into functional divergence and adaptation to different ecological niches.

What structural differences exist between thermophilic and mesophilic UPF0344 homologs?

While specific structural data for GWCH70_0687 is not directly available from the search results, comparative analysis between thermophilic (Geobacillus) and mesophilic (Bacillus, Staphylococcus) homologs is valuable for understanding thermal adaptation mechanisms:

• Thermophilic homologs typically exhibit:

  • Increased hydrophobic core packing

  • Higher proportion of charged surface residues forming salt bridges

  • Reduced conformational flexibility in loop regions

  • Preference for certain amino acids (e.g., increased Arg, Glu, decreased Ala, Ser)

• Predictive structural models suggest:

  • The alpha-helical transmembrane regions may show differential packing between thermophilic and mesophilic variants

  • Surface-exposed regions likely contain the greatest sequence divergence

  • Conserved residues likely correspond to functionally critical positions

Experimental comparison of thermal stability between these homologs could provide insights into thermoadaptation mechanisms and conserved functional elements.

What are the challenges in crystallizing membrane-associated proteins like GWCH70_0687?

Crystallization of membrane-associated proteins like GWCH70_0687 presents several significant challenges requiring specialized approaches:

• Detergent selection:

  • Systematic screening of detergent types (maltoside, glucoside, fos-choline series)

  • Evaluation of detergent concentration effects on protein stability

  • Assessment of mixed detergent systems for optimal crystal packing

• Lipid supplementation:

  • Addition of specific lipids to maintain native-like environment

  • Lipid cubic phase crystallization as an alternative approach

  • Bicelle formulations for membrane protein crystallization

• Construct optimization:

  • Truncation of disordered regions while preserving core structure

  • Introduction of fusion partners (T4 lysozyme, BRIL) to increase polar surface area

  • Surface entropy reduction mutagenesis to promote crystal contacts

• Crystallization conditions:

  • Expanded screening coverage compared to soluble proteins

  • Temperature optimization often critical for membrane protein stability

  • Extended incubation times for crystal growth (weeks to months)

The relatively small size of GWCH70_0687 (117 amino acids) may simplify some aspects of crystallization, particularly if domains can be expressed independently.

How can isotope labeling of GWCH70_0687 facilitate structural NMR studies?

For NMR structural studies of GWCH70_0687, isotope labeling strategies must be carefully designed considering its membrane-associated nature:

• Expression optimization for isotope incorporation:

  • Minimal media formulation with 15N-ammonium salts and 13C-glucose as sole nitrogen and carbon sources

  • Optimization of induction conditions to maximize labeled protein yield

  • Selective amino acid labeling for specific structural questions

• Sample preparation considerations:

  • Selection of detergent micelles with favorable NMR properties (e.g., DPC, LPPG)

  • Deuteration strategies to reduce proton density and improve spectral quality

  • Nanodiscs as alternative membrane mimetics for more native-like environment

• Specialized NMR experiments:

  • TROSY-based pulse sequences for improved spectral resolution

  • Paramagnetic relaxation enhancement for distance constraints

  • Residual dipolar coupling measurements for orientation information

The modest size of GWCH70_0687 (117 amino acids) makes it amenable to solution NMR approaches with appropriate optimization of experimental conditions and labeling strategies.

What is the optimal approach for developing antibodies against GWCH70_0687?

Developing specific antibodies against GWCH70_0687 requires strategic epitope selection and immunization protocols:

• Epitope selection strategies:

  • Bioinformatic prediction of surface-exposed, antigenic regions

  • Focus on N-terminal or C-terminal regions typically more accessible in membrane proteins

  • Synthetic peptide approach for predicted hydrophilic loops between transmembrane domains

• Immunization considerations:

  • Use of full-length protein in detergent micelles or liposomes

  • Multiple immunization formats (DNA, protein, peptide-carrier conjugates)

  • Adjuvant selection appropriate for membrane protein antigens

• Antibody validation methodology:

  • Western blotting against recombinant protein and native Geobacillus extracts

  • Immunoprecipitation efficiency assessment

  • Cross-reactivity testing against homologs from related species

  • Immunofluorescence microscopy to confirm predicted cellular localization

The availability of highly purified recombinant GWCH70_0687 (>90% purity) provides excellent starting material for both immunization and validation steps.

What approach should be used to detect protein-protein interactions involving GWCH70_0687?

Detecting protein-protein interactions for membrane-associated proteins like GWCH70_0687 requires specialized approaches:

The His-tagged recombinant GWCH70_0687 is particularly suitable for pull-down approaches as an initial screen, followed by validation using complementary methods.

How can GWCH70_0687 research contribute to understanding thermophilic adaptation mechanisms?

As a protein from the thermophilic Geobacillus species, GWCH70_0687 provides an excellent model for studying thermoadaptation of membrane proteins:

• Comparative biochemical characterization:

  • Thermal stability assays comparing GWCH70_0687 with mesophilic homologs

  • Circular dichroism to assess secondary structure retention at elevated temperatures

  • Differential scanning calorimetry to determine precise melting temperatures

  • Activity assays (once function is established) at varying temperatures

• Sequence-structure-function relationships:

  • Identification of amino acid substitutions unique to thermophilic variants

  • Mutational analysis to establish contribution of specific residues to thermostability

  • Chimeric protein construction exchanging domains between thermophilic and mesophilic homologs

• Applications to protein engineering:

  • Rational design principles derived from naturally thermostable membrane proteins

  • Potential biotechnological applications in high-temperature industrial processes

  • Engineered thermostable variants of mesophilic membrane proteins

Understanding the molecular basis of thermostability in proteins like GWCH70_0687 has both fundamental significance and potential biotechnological applications.

What strategies can overcome challenges in expressing thermophilic membrane proteins in mesophilic hosts?

Expression of thermophilic membrane proteins like GWCH70_0687 in standard laboratory hosts (E. coli, yeast) presents unique challenges requiring targeted strategies:

• Codon optimization considerations:

  • Adaptation to host codon usage while preserving mRNA secondary structure elements

  • Specific attention to rare codons at critical folding junctures

  • Modulation of translation rate through strategic codon selection

• Expression temperature strategies:

  • Lower temperature expression (16-25°C) to balance between protein folding and host tolerance

  • Heat shock pre-conditioning of expression cultures

  • Consideration of psychrophilic expression hosts for particularly challenging proteins

• Chaperone co-expression approaches:

  • Co-expression of general chaperones (GroEL/ES, DnaK/J)

  • Addition of specialized membrane protein folding chaperones (YidC)

  • Potential benefit from co-expression of thermophilic chaperones

• Fusion partner selection:

  • N-terminal fusions that promote membrane insertion (Mistic, YnaI)

  • Solubility-enhancing tags that can later be removed (MBP, SUMO)

  • Careful design of linker regions between fusion partners and target protein

The successful expression of GWCH70_0687 in E. coli demonstrates that these challenges can be overcome with proper optimization.

What are the most promising approaches for elucidating the function of GWCH70_0687?

Given the current classification of GWCH70_0687 as a hypothetical protein , several complementary approaches show particular promise for functional characterization:

• Comprehensive phylogenetic profiling:

  • Identification of co-occurring genes across diverse genomes

  • Gene neighborhood analysis for functional context

  • Correlation with specific ecological niches or metabolic capabilities

• High-throughput phenotypic screening:

  • Growth condition sensitivity profiling of knockout/overexpression strains

  • Metabolomic analysis to identify altered metabolic pathways

  • Transcriptional response analysis under stress conditions

• Cryo-EM structural determination:

  • Potential for resolving membrane protein structures without crystallization

  • Visualization of interaction partners in complex preparations

  • Structural comparison with functionally characterized homologs

• Integration with systems biology approaches:

  • Incorporation into genome-scale metabolic models

  • Network analysis to predict functional associations

  • Machine learning algorithms trained on multi-omics datasets

The most effective strategy will likely combine these approaches to build multiple lines of evidence supporting functional hypotheses.

How can researchers effectively collaborate on GWCH70_0687 characterization across different specialties?

Characterizing hypothetical proteins like GWCH70_0687 benefits from multidisciplinary collaboration:

• Shared material resources:

  • Distribution of validated expression constructs and purification protocols

  • Access to specialized antibodies and detection reagents

  • Development of standardized activity assays once identified

• Complementary expertise integration:

  • Bioinformaticians providing sequence and structural predictions

  • Microbiologists establishing physiological context and phenotypes

  • Structural biologists determining three-dimensional architecture

  • Biochemists characterizing molecular interactions and activities

• Data sharing framework:

  • Centralized repositories for experimental data

  • Standardized formats for results communication

  • Regular virtual or in-person working group meetings

• Collaborative funding strategies:

  • Multi-institutional grant proposals

  • Industry partnerships for applied aspects

  • Resource sharing to maximize efficiency

The availability of commercial recombinant GWCH70_0687 provides a standardized starting point for collaborative research efforts.