Recombinant Geobacillus stearothermophilus Potassium-transporting ATPase A chain (kdpA)

Shipped with Ice Packs
In Stock

Description

Introduction to Geobacillus stearothermophilus and kdpA

Geobacillus stearothermophilus (formerly known as Bacillus stearothermophilus) is a gram-positive, thermophilic bacterium characterized by its remarkable heat resistance . This organism has adapted to survive in extreme temperature environments, making its proteins particularly interesting for their thermostability and potential biotechnological applications. Among the various proteins expressed by this organism, the Potassium-transporting ATPase A chain (kdpA) plays a crucial role in maintaining potassium homeostasis, which is essential for cellular function.

The kdpA protein is part of the KdpFABC complex, an inducible high-affinity K⁺ transport system that allows bacteria to maintain potassium homeostasis under various environmental conditions. This P-type ATPase system is particularly important when potassium is limited in the environment, allowing the organism to scavenge and transport potassium ions against their concentration gradient, using ATP hydrolysis as an energy source.

Protein Identity and Classification

The Potassium-transporting ATPase A chain from G. stearothermophilus is officially classified with the enzyme classification number EC 3.6.3.12 . This classification identifies it as an ATP phosphohydrolase that specifically transports potassium ions. In the UniProt database, the protein is registered under accession number P94456, providing a standardized reference for research and molecular biology applications .

The protein is known by several alternative names that reflect its function:

  • ATP phosphohydrolase [potassium-transporting] A chain

  • Potassium-binding and translocating subunit A

  • Potassium-translocating ATPase A chain

The gene encoding this protein is designated as kdpA, which is consistent with the nomenclature used for similar proteins in other bacterial species .

Expression Systems

Recombinant kdpA is produced using different expression systems, which can affect the protein's characteristics and applications. According to the available product information, the protein can be expressed in at least two different systems:

  1. Bacterial expression system (E. coli): This system is used for efficient production of the recombinant protein in a prokaryotic environment .

  2. Mammalian cell expression system: This alternative production method may provide different post-translational modifications or folding characteristics compared to the bacterial system .

The choice of expression system depends on the specific research requirements, including the need for particular post-translational modifications or folding patterns.

Protein Quality and Purity

The commercially available recombinant kdpA protein typically achieves a purity level of >85% as determined by SDS-PAGE analysis . This level of purity is suitable for most research applications, including enzymatic studies, antibody production, and structural investigations.

Temperature Requirements

Proper storage temperature is critical for maintaining the protein's stability and activity. The recommended storage conditions are:

  • Regular storage: -20°C

  • Extended storage: -20°C to -80°C

For working solutions, it is recommended to store aliquots at 4°C for up to one week to minimize freeze-thaw cycles .

Shelf Life

The shelf life of recombinant kdpA varies depending on the formulation:

  • Liquid form: 6 months at -20°C/-80°C

  • Lyophilized form: 12 months at -20°C/-80°C

These shelf life estimates assume proper storage conditions are maintained consistently.

Handling Recommendations

To preserve the integrity and activity of the protein, several handling recommendations are provided:

  • Centrifuge vials briefly before opening to bring contents to the bottom

  • Avoid repeated freezing and thawing, which can lead to protein denaturation and loss of activity

  • For reconstitution of lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Adding glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) helps preserve stability during long-term storage

Applications and Research Relevance

While specific applications of the recombinant G. stearothermophilus kdpA protein are not explicitly detailed in the search results, potassium-transporting ATPases generally have significant research value in several areas:

  1. Structural biology studies to understand membrane transport mechanisms

  2. Enzymatic assays investigating ATP hydrolysis and ion transport

  3. Development of antibodies for detection and localization studies

  4. Investigation of bacterial adaptation to potassium-limited environments

  5. Comparative studies with homologous proteins from other species

The thermostability inherent to proteins from G. stearothermophilus makes this particular kdpA protein potentially valuable for applications requiring enhanced temperature tolerance.

Comparison with Other Bacterial Transport Systems

Although the search results do not provide direct comparisons between G. stearothermophilus kdpA and similar proteins from other species, it's worth noting that potassium transport systems are widely distributed among bacteria. The KdpFABC complex, of which kdpA is a component, represents one of the most sophisticated bacterial potassium uptake systems, distinct from other potassium transporters like Ktr and Kdp.

G. stearothermophilus, as a thermophilic organism, likely possesses adaptations in its kdpA protein that enhance stability at elevated temperatures compared to mesophilic bacteria. These adaptations might include additional disulfide bonds, increased hydrophobic interactions, or other structural features that confer thermostability.

Future Research Directions

Based on the available information, several promising research directions for G. stearothermophilus kdpA could be suggested:

  1. Detailed structural characterization using X-ray crystallography or cryo-electron microscopy to understand the thermostable adaptations

  2. Functional studies comparing potassium transport efficiency at different temperatures

  3. Engineering studies to transfer thermostable properties to homologous proteins from mesophilic organisms

  4. Investigation of the protein's role in the bacterium's adaptation to extreme environments

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for your order.
Synonyms
kdpA; Potassium-transporting ATPase potassium-binding subunit; ATP phosphohydrolase [potassium-transporting] A chain; Potassium-binding and translocating subunit A; Potassium-translocating ATPase A chain; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Geobacillus stearothermophilus (Bacillus stearothermophilus)
Target Names
kdpA
Target Protein Sequence
MSFRNIHYFLLLIVIAVPLGKYLYVAFFEKGKIDRFFSPIEAVIYRLSGIRSLEEMTWKS YCTALLIVNAALLGISYGLLRIQHYLPLNGAKVENMEPTLTFNTVVSFMTNTNLQ
Uniprot No.

Target Background

Function
This subunit is a component of the high-affinity ATP-driven potassium transport (or Kdp) system. It catalyzes the hydrolysis of ATP, which is coupled with the electrogenic transport of potassium into the cytoplasm. This subunit specifically binds and transports potassium across the cytoplasmic membrane.
Protein Families
KdpA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of the Potassium-transporting ATPase A chain (kdpA) in Geobacillus stearothermophilus?

The Potassium-transporting ATPase A chain (kdpA) is a critical component of the KdpFABC complex, which facilitates active potassium ion transport across cellular membranes. This system is particularly important under conditions of potassium limitation or osmotic stress, where maintaining intracellular potassium levels becomes essential for cellular homeostasis and metabolic function. In Geobacillus stearothermophilus, a thermophilic bacterium, kdpA plays a role in adapting to high-temperature environments by ensuring ionic stability and supporting enzymatic activities that are temperature-sensitive .

The kdpA subunit specifically contributes to the selectivity and transport mechanism by forming part of the transmembrane pore structure. It interacts with other subunits, such as KdpB and KdpC, to couple ATP hydrolysis with ion transport. Structural studies have revealed that kdpA contains regions that facilitate potassium ion binding and translocation through conformational changes driven by ATP hydrolysis cycles .

How can recombinant Geobacillus stearothermophilus kdpA be expressed and purified for experimental studies?

The expression and purification of recombinant kdpA typically involve cloning the kdpA gene into an appropriate expression vector, such as pET-series plasmids, followed by transformation into Escherichia coli host strains like BL21(DE3). The gene is often fused with tags (e.g., His-tag) to simplify purification via affinity chromatography .

To ensure optimal expression, researchers may need to optimize induction conditions, such as IPTG concentration and temperature. For thermophilic proteins like kdpA, maintaining elevated culture temperatures during expression can enhance protein folding and stability. After cell lysis, purification steps include affinity chromatography (e.g., Ni-NTA columns), followed by size-exclusion chromatography to isolate the protein in its native conformation .

Detailed protocols often include mutagenesis techniques to engineer variants of kdpA for functional studies or thermostability analyses. Expression systems must also account for potential toxicity or aggregation issues associated with membrane proteins like kdpA .

What experimental approaches are used to study the structure-function relationship of kdpA?

To investigate the structure-function relationship of kdpA, researchers employ a combination of structural biology techniques and functional assays:

Cryo-Electron Microscopy (Cryo-EM)

Cryo-EM has been instrumental in resolving high-resolution structures of membrane protein complexes like KdpFABC. For kdpA, Cryo-EM can reveal conformational states during potassium transport cycles, highlighting interactions with other subunits and nucleotide-binding domains .

X-ray Crystallography

Although challenging for membrane proteins, X-ray crystallography can provide atomic-level details about specific domains within kdpA that contribute to ion selectivity and transport mechanisms.

Site-Directed Mutagenesis

Mutagenesis experiments allow researchers to pinpoint amino acid residues critical for kdpA's function. For example, altering residues within the selectivity filter region can elucidate their role in potassium binding and translocation .

Functional Assays

ATPase activity assays are commonly used to measure the coupling efficiency between ATP hydrolysis and potassium transport. These assays often involve monitoring inorganic phosphate release or using fluorescent probes sensitive to ion gradients .

What challenges arise when studying recombinant kdpA in vitro?

Studying recombinant kdpA presents several challenges due to its nature as a membrane protein:

Membrane Integration

Recombinant kdpA requires integration into lipid bilayers or artificial membrane systems (e.g., liposomes) to mimic its native environment. Achieving correct orientation and functionality in these systems can be technically demanding .

Stability at Elevated Temperatures

As a thermophilic protein, kdpA exhibits enhanced thermostability but may denature under non-optimal conditions during purification or storage. Researchers must carefully control buffer compositions and temperature during experiments .

Functional Reconstitution

Reconstituting kdpA into functional complexes with other KdpFABC subunits is necessary for studying its role within the complete transport system. This involves co-expression strategies or sequential assembly protocols that can complicate experimental workflows .

How do structural studies reconcile discrepancies in functional data for kdpA?

Discrepancies between structural models and functional data often arise due to differences in experimental conditions or resolution limitations in structural studies. For example, Cryo-EM studies have sometimes shown immobile regions within kdpA that contradict functional observations suggesting dynamic conformational changes during ion transport .

To address these contradictions:

  • Researchers integrate structural data with biochemical assays to validate proposed mechanisms.

  • Advanced computational modeling techniques are employed to simulate dynamic processes not captured in static structural snapshots.

  • Comparative analyses with homologous systems (e.g., TrkH or KtrB) help contextualize findings within broader transport protein families .

What methods are available for analyzing ATPase activity in recombinant systems?

ATPase activity assays are critical for understanding how kdpA couples ATP hydrolysis with potassium transport:

Enzymatic Assays

These involve measuring the release of inorganic phosphate (PiP_i) from ATP hydrolysis using colorimetric reagents like malachite green.

Fluorescent Probes

Fluorescent probes sensitive to changes in ion concentrations can indirectly assess ATPase activity by monitoring potassium flux across reconstituted membranes.

Isothermal Titration Calorimetry (ITC)

ITC provides insights into thermodynamic parameters associated with ATP binding and hydrolysis cycles.

Researchers often compare wild-type kdpA with mutant variants to identify residues critical for catalytic efficiency or coupling fidelity .

How does the thermostability of Geobacillus stearothermophilus proteins influence their experimental applications?

The inherent thermostability of Geobacillus stearothermophilus proteins like kdpA offers several advantages for experimental applications:

  • Enhanced Folding Efficiency: Thermostable proteins tend to fold correctly even under challenging expression conditions.

  • Extended Activity Range: These proteins remain active at elevated temperatures, enabling studies under conditions closer to their natural habitat.

  • Improved Crystallization: Higher stability often correlates with better crystallization outcomes due to reduced conformational heterogeneity.

What are the implications of studying kdpA for understanding potassium homeostasis in extreme environments?

Studying kdpA provides valuable insights into how organisms maintain ionic balance under extreme environmental conditions:

  • Adaptation Mechanisms: Thermophilic bacteria like Geobacillus stearothermophilus rely on efficient potassium transport systems to survive high-temperature stress.

  • Biotechnological Applications: Understanding these mechanisms can inform strategies for engineering robust microbial strains for industrial processes.

  • Evolutionary Insights: Comparative analyses with mesophilic systems highlight evolutionary adaptations that enhance protein stability and function at elevated temperatures .

How can computational modeling complement experimental studies on kdpA?

Computational modeling serves as a powerful tool for complementing experimental studies on kdpA:

  • Molecular Dynamics Simulations: These simulations provide dynamic insights into conformational changes during ion transport cycles.

  • Docking Studies: Computational docking helps predict interactions between kdpA and ligands such as ATP or inhibitors.

  • Energy Calculations: Models can estimate binding affinities and transition state energies that are challenging to measure experimentally.

By integrating computational predictions with empirical data, researchers can refine mechanistic models and design targeted experiments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.