Recombinant Geobacillus stearothermophilus PTS system glucose-specific EIICBA component (ptsG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ptsG; PTS system glucose-specific EIICBA component; EII-Glc/EIII-Glc; EIICBA-Glc; EIICBA-Glc 1 [Includes: Glucose permease IIC component; PTS system glucose-specific EIIC component; Glucose-specific phosphotransferase enzyme IIB component; PTS system glucose-specific EIIB component; Glucose-specific phosphotransferase enzyme IIA component; PTS system glucose-specific EIIA component]; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-324
Protein Length
full length protein
Species
Geobacillus stearothermophilus (Bacillus stearothermophilus)
Target Names
ptsG
Target Protein Sequence
HLLNVKIGMTFSGGVIDFLLFGVLPNRTAWWLVIPVGLVFAVIYYFGFRFAIRKWDLATP GREKTVEEAPKAEAAAAGDLPYEVLAALGGKENIEHLDACITRLRVSVHDIGRVDKDRLK ALGAAGVLEVGNNVQAIFGPKSDMLKGQIQDIMQGKAPARAEEKPKTAASEAAESETIAS PMSGEIVPLAEVPDQVFSQKMMGDGFAVMPTDGTVVSPVDGKIINVFPTKHAIGIQSAGG HEILIHVGIDTVKLNGQGFEALVKEGDEVKKGQPILRVDLDYVKQNAPSIVTPVIFTNLQ AGETVHVNKQGPVARGEDAVVTIR
Uniprot No.

Target Background

Function

The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a primary carbohydrate active transport system, catalyzes the phosphorylation and simultaneous translocation of sugar substrates across the cell membrane. This system plays a crucial role in glucose transport.

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the optimal expression system for producing recombinant G. stearothermophilus ptsG protein?

The optimal expression system depends on your research objectives. For high-yield expression of G. stearothermophilus proteins, several systems have proven effective:

  • E. coli expression systems: Provide good yields for thermostable proteins and are well-suited for structural studies. For the ptsG protein specifically, E. coli BL21(DE3) with a pET vector system under T7 promoter control often yields functional protein.

  • Pichia pastoris: As demonstrated with G. stearothermophilus α-amylase, P. pastoris GS115 under methanol-inducible AOX promoter achieved 28.6 U mL⁻¹ at 120h post-induction . This system is particularly advantageous for proteins requiring post-translational modifications.

  • Baculovirus expression system: Recommended for membrane proteins like ptsG when proper folding and insertion are critical. This system has been used successfully for other G. stearothermophilus proteins .

For membrane proteins like ptsG, detergent optimization during purification is crucial regardless of the expression system selected.

How does G. stearothermophilus growth temperature affect recombinant protein expression and activity?

Temperature significantly impacts both growth and protein expression in G. stearothermophilus:

  • G. stearothermophilus thrives at 55-65°C (optimal range) but can grow between 35-75°C

  • Maximum specific growth rate (μopt) occurs at 61.82°C

  • Expression temperature affects protein folding and activity:

Temperature (°C)Growth Rate (relative)Protein ExpressionNotes
35-45LowLower yield, possibly higher solubilityBelow minimum growth temperature (Tmin = 33.76°C)
55-62OptimalHighest yieldNear optimal growth temperature
>65DecreasingReduced yieldApproaches maximum temperature (Tmax = 68.14°C)

For recombinant expression of thermostable proteins like ptsG in mesophilic hosts (E. coli, P. pastoris), lower induction temperatures (18-30°C) often improve folding while sacrificing expression rate. When expressing in the native host, temperatures close to 55°C maximize both growth and protein production.

What are the recommended methods for measuring transport activity of recombinant G. stearothermophilus ptsG?

To assess functional activity of the recombinant glucose-specific EIICBA component (ptsG), researchers should consider:

Whole-cell glucose uptake assay:

  • Transform expression host with recombinant ptsG construct

  • Induce protein expression and confirm by Western blot using the tag (see product #11 specifications)

  • Measure glucose uptake using radiolabeled glucose (¹⁴C-glucose) or fluorescent glucose analogs (2-NBDG)

  • Compare uptake rates between induced and uninduced cells

Reconstituted system assay:

  • Purify the ptsG protein using affinity chromatography (based on the tag determined during production)

  • Reconstitute in proteoliposomes or nanodiscs

  • Set up a coupled assay with purified PTS components (Enzyme I and HPr)

  • Monitor PEP-dependent phosphorylation of glucose

  • Measure activity at elevated temperatures (45-60°C) to match G. stearothermophilus physiological conditions

Controls and considerations:

  • Include temperature controls (25°C, 37°C, 55°C) to demonstrate thermostability

  • Use detergent screening to identify optimal conditions for membrane protein solubilization

  • Confirm protein integrity using circular dichroism before activity measurements

How can researchers effectively design growth media for G. stearothermophilus studies?

Designing appropriate growth media for G. stearothermophilus requires consideration of its thermophilic nature and nutritional requirements:

Base medium composition:

  • Rich medium (for maximum biomass): beef extract, soy peptone, 0.2% NaCl buffered with K₂HPO₄/KH₂PO₄

  • Minimal medium: glucose and mineral salts for prototrophic strains

  • For auxotrophic strains: supplement with biotin, thiamine, nicotinic acid, and DL-methionine

Design of experiments (DOE) approach:

  • Implement factorial design to test interactions between nutrients

  • Investigate carbon source, nitrogen source, mineral composition, and trace elements individually

  • Optimize by response surface methodology, measuring growth rate and final biomass

  • Validate in different culture formats (shake flask vs. bioreactor conditions)

This approach has been successfully used to develop defined media for related Geobacillus species (G. thermoglucosidans) , providing a robust methodology applicable to G. stearothermophilus.

pH and temperature considerations:

  • Maintain pH between 6.2-7.5 (optimal range)

  • Temperature should be maintained at 55-62°C for optimal growth

  • When working with recombinant ptsG, ensure temperature stability of the incubation equipment

What phosphorylation cascade mechanisms are involved in G. stearothermophilus PTS system function?

The phosphorylation cascade in G. stearothermophilus PTS system follows conserved mechanisms with thermostable components:

Complete phosphorylation pathway:

  • Phosphoenolpyruvate (PEP) → Enzyme I (EI)

  • EI-P → HPr protein

  • HPr-P → Domain A of ptsG (EIICBA)

  • Domain A-P → Domain B

  • Domain B-P → glucose (transported via Domain C)

Thermophilic adaptations:

  • Higher structural rigidity of PTS components

  • Altered protein-protein interaction surfaces to maintain binding affinity at elevated temperatures

  • Modified active site architecture to preserve catalytic efficiency

Regulatory aspects:

  • When G. stearothermophilus encounters carbon source downshift, it triggers the stringent response via (p)ppGpp accumulation

  • This response is mediated by two distinct enzymes: (p)ppGpp synthetase I (ribosome-associated) and synthetase II (found in S100 fraction)

  • The cross-talk between PTS-mediated carbon regulation and stringent response represents an important regulatory network for nutrient adaptation

How can researchers utilize recombinant G. stearothermophilus ptsG in developing high-temperature biosensors?

Developing thermostable biosensors using G. stearothermophilus ptsG leverages its glucose-specific transport properties and thermostability:

Methodological approach:

  • Engineer the ptsG protein as a fusion with reporter systems:

    • Fluorescent proteins (thermostable GFP variants)

    • Bioluminescent proteins (optimized for high-temperature activity)

    • Electrochemical coupling proteins

  • Design detection platforms:

    • Whole-cell biosensors expressing recombinant ptsG

    • Purified protein immobilized on nanomaterials

    • Reconstituted proteoliposomes with integrated detection systems

  • Validation protocol:

    • Test glucose detection across temperature range (35-70°C)

    • Determine specificity against other sugars

    • Assess stability under repeated use conditions

    • Compare response time at different temperatures

Advantages over mesophilic systems:

  • Extended operational lifespan at elevated temperatures

  • Resistance to denaturation during storage

  • Functionality in harsh environments where mesophilic proteins would fail

  • Potential application in industrial processes requiring continuous high-temperature monitoring

What approaches are recommended for elucidating the role of ptsG in the stress response of G. stearothermophilus?

To investigate ptsG's role in stress response, researchers should implement a comprehensive approach combining genetic and physiological methods:

Experimental design:

  • Construction of genetic tools:

    • Generate ptsG deletion mutant using thermostable selection markers

    • Create complementation strains with wild-type and modified ptsG

    • Develop inducible expression systems functional at high temperatures

  • Phenotypic characterization under stress conditions:

    • Thermal stress (temperature shifts)

    • Nutrient limitation (carbon source downshift)

    • Osmotic stress

    • pH stress

  • Comparative transcriptomics:

    • RNA-seq analysis comparing wild-type and ΔptsG strains under stress

    • Identify differentially expressed genes in metabolic and stress response pathways

    • Map potential regulatory networks

  • Metabolomics analysis:

    • Quantify changes in central carbon metabolites

    • Monitor (p)ppGpp levels using established methods

    • Analyze phosphorylation patterns of PTS components

Integration with stringent response:
Since G. stearothermophilus possesses two distinct (p)ppGpp synthetases responding to different stresses , researchers should investigate potential connections between glucose transport via ptsG and activation of these synthetases, particularly during carbon source shifts.

How can researchers address the common challenges in purifying functional recombinant G. stearothermophilus ptsG?

Purifying membrane proteins like ptsG presents several challenges that can be addressed systematically:

Common challenges and solutions:

  • Low expression levels:

    • Optimize codon usage for expression host

    • Test different promoter strengths

    • Evaluate expression at lower temperatures with extended induction times

    • Consider fusion tags that enhance solubility (MBP, SUMO)

  • Protein aggregation:

    • Screen detergents systematically (start with DDM, LMNG, and CHAPS)

    • Test extraction buffers with varying ionic strengths

    • Include stabilizing agents like glycerol (10-20%)

    • Consider nanodiscs or SMALPs for detergent-free purification

  • Protein instability:

    • Include protease inhibitors during all purification steps

    • Maintain elevated temperature (30-45°C) during purification

    • Add glucose as a stabilizing ligand

    • Consider chemical crosslinking for structural studies

  • Loss of function:

    • Develop activity assays applicable at each purification stage

    • Monitor protein folding using circular dichroism

    • Perform thermal shift assays to assess stability

    • Test reconstitution in different lipid compositions

Purification protocol optimization table:

Purification StageCritical ParametersMonitoring Method
Membrane isolationLysis buffer composition, temperatureMembrane protein content (BCA)
SolubilizationDetergent type/concentration, time, temperatureSolubilized protein yield
Affinity chromatographyFlow rate, binding/washing/elution conditionsSDS-PAGE, Western blot
Size exclusionBuffer composition, flow ratePeak symmetry, oligomeric state
Functional reconstitutionLipid composition, protein:lipid ratioTransport activity assay

What are the most effective approaches to study the interaction between ptsG and other components of the G. stearothermophilus PTS system?

Studying protein-protein interactions involving membrane proteins requires specialized approaches:

Recommended methodologies:

  • In vivo approaches:

    • Bacterial two-hybrid systems adapted for thermophiles

    • Split-protein complementation assays

    • FRET/BRET using thermostable fluorescent proteins

    • In vivo crosslinking with photo-activatable amino acids

  • In vitro approaches:

    • Surface plasmon resonance with immobilized ptsG

    • Isothermal titration calorimetry at elevated temperatures

    • Microscale thermophoresis

    • Co-immunoprecipitation using antibodies against tags

  • Structural approaches:

    • Hydrogen-deuterium exchange mass spectrometry

    • Cryo-electron microscopy of the assembled complex

    • Disulfide crosslinking to map interaction surfaces

    • Molecular dynamics simulations at elevated temperatures

  • Kinetic coupling assays:

    • Develop enzymatic assays that measure phosphotransfer between components

    • Monitor the rate-limiting steps in the complete PTS phosphorylation cascade

    • Assess how temperature affects the kinetics of each transfer step

Data integration strategy: Combine multiple complementary approaches and perform experiments at different temperatures (30°C, 45°C, 60°C) to understand the thermodynamic and kinetic parameters governing these interactions under conditions relevant to G. stearothermophilus physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.