Recombinant Geobacillus thermodenitrificans ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Geobacillus thermodenitrificans ATP Synthase Subunit b (atpF)

Geobacillus thermodenitrificans ATP synthase subunit b (atpF) is a component of the ATP synthase complex found in the thermophilic bacterium Geobacillus thermodenitrificans . ATP synthase, also known as F1F0-ATPase or Complex V, is an enzyme that produces ATP from ADP and inorganic phosphate, utilizing a proton gradient across a membrane . This enzyme is essential for energy production in all living cells .

Biological Significance

The ATP synthase subunit b (atpF) is a crucial part of the F0 sector of the ATP synthase complex, which is embedded in the cell membrane . Subunit b is involved in the proton translocation pathway, which drives the rotation of the F0 sector and, consequently, ATP synthesis . Studies on bacterial ATP synthases have been conducted for decades due to the ease of genetic manipulation .

Geobacillus thermodenitrificans

Geobacillus thermodenitrificans is a thermophilic bacterium . The genome of Geobacillus thermodenitrificans NG80-2 reveals its ability to adapt to diverse environments, including oil reservoirs, through genes for utilizing various energy sources, nutrient uptake, detoxification, and a flexible respiration system .

Research Applications

Recombinant forms of this protein are utilized in various research applications:

  • ELISA: Recombinant Geobacillus thermodenitrificans ATP synthase subunit b (atpF) is used in ELISA (Enzyme-Linked Immunosorbent Assay) .

  • Antibacterial Research: ATP synthase inhibitors have been proposed as a means to combat antibiotic resistance .

ATP Synthase Inhibitors

Several compounds inhibit ATP synthase, including resveratrol, venturicidin A, bedaquiline, tomatidine, piceatannol, oligomycin A, and N,N-dicyclohexylcarbodiimide . These inhibitors can target different subunits or regions of the ATP synthase complex, affecting its activity .

YjbH and Oxidative Stress

Geobacillus thermodenitrificans YjbH (GtYjbH) can complement a B. subtilis yjbH null mutant and shows high activity in vitro when combined with ClpXP and Spx . The complemented strain responds to oxidative stress by inducing Spx activity .

Mutations and Interactions

Mutations in subunit b of ATP synthase can disrupt enzyme assembly or ATP hydrolysis . The N-terminal α-helix of subunit b interacts with subunit a, and mutations in this region can be detrimental to the complex's assembly and activity .

Tables

PropertyDescription
OrganismGeobacillus thermodenitrificans
Protein NameATP synthase subunit b (atpF)
Alternative NamesATP synthase F(0) sector subunit b, ATPase subunit I, F-type ATPase subunit b
Gene NameatpF
FunctionComponent of the ATP synthase complex, involved in proton translocation and ATP synthesis
ApplicationsELISA, antibacterial research
Sequence Length180 amino acids
StorageStore at -20℃, for extended storage, conserve at -20℃ or -80℃.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments default to blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF; GTNG_3308; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Geobacillus thermodenitrificans (strain NG80-2)
Target Names
atpF
Target Protein Sequence
MLAALQTAALGAAAGHGAVNSGDIIFQLVAFILLMLLLRKFAWGPLMGVMKQREEHIANE IDQAEKRRQEAEKLLEEQRELLKQSRQEAQTILENARKLAEEQKEQIVASARAEAERVKE AAKQEIEREKEQAMAALREQVASLSVLIASKVIERELTEQDQRKLIEAYIKDIQEVGGAR
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP in the presence of a proton or sodium gradient. These enzymes consist of two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. This subunit is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b (atpF) from Geobacillus thermodenitrificans and what is its biological function?

ATP synthase subunit b (atpF) is a component of the F0 sector of ATP synthase in Geobacillus thermodenitrificans. ATP synthase uses a unique rotational mechanism to convert chemical energy into mechanical energy and back into chemical energy . The F0 sector is embedded in the membrane and contains the c-ring, which is responsible for proton translocation. Subunit b forms part of the peripheral stator stalk that connects the F1 and F0 sectors and holds the α3β3 catalytic core stationary while the central stalk rotates . This stator function is critical for the enzyme's ability to couple proton flow through F0 with ATP synthesis in F1.

How does the structure of G. thermodenitrificans atpF differ from mesophilic homologs?

Thermophilic proteins achieve stability at high temperatures through several mechanisms that distinguish them from their mesophilic counterparts:

  • Increased number of ionic interactions

  • Shorter loops between secondary structure elements

  • Tighter packing of hydrophobic regions

Comparison of G. thermodenitrificans atpF with mesophilic homologs reveals:

These structural differences contribute to the protein's ability to maintain its native conformation and function at temperatures that would denature most mesophilic proteins . The sequence analysis of G. thermodenitrificans atpF shows a higher proportion of alanine, arginine, and glutamic acid residues compared to E. coli atpF, which correlates with enhanced thermostability .

What are the optimal conditions for recombinant expression of G. thermodenitrificans atpF?

For successful expression of recombinant G. thermodenitrificans atpF, the following methodological approach is recommended:

Expression System:

  • E. coli strain DK8 (with deleted endogenous ATP synthase genes) has been successfully used for heterologous expression of thermophilic ATP synthase components

  • Alternative expression hosts include yeast systems for specific applications

Expression Conditions:

  • Culture in 2× TY medium at 37°C for 20 hours

  • Induction with appropriate inducer (IPTG for T7-based systems)

  • Harvest cells by centrifugation at 5400g

  • Resuspend in lysis buffer containing:

    • 50 mM Tris-HCl pH 7.4

    • 5 mM MgCl₂

    • 10% (w/v) glycerol

    • 5 mM 6-aminocaproic acid

    • 5 mM benzamidine

    • 1 mM PMSF

Plasmid Construction:
Optimal expression has been achieved using vectors that provide an N-terminal His-tag for purification purposes. The full-length atpF gene (encoding amino acids 1-176) should be cloned with appropriate restriction sites and under the control of a strong, inducible promoter .

What is the most effective purification strategy for recombinant G. thermodenitrificans atpF?

Purification of recombinant G. thermodenitrificans atpF typically follows this methodological sequence:

  • Cell Lysis and Membrane Isolation:

    • Lyse cells using EmulsiFlex-C3 homogenizer (15-20 kbar pressure, three passes)

    • Remove cell debris by centrifugation at 12,250g for 20 minutes

    • Collect membrane fraction by ultracentrifugation at 184,000g for 1 hour

    • Wash membrane fraction twice with lysis buffer

  • Solubilization:

    • Resuspend membranes in solubilization buffer containing 50 mM Tris-HCl pH 7.4, 10% glycerol, 250 mM sucrose, and protease inhibitors

    • Solubilize with 1% (w/v) glycol-diosgenin (GDN) or alternative detergent suitable for membrane proteins

    • Incubate for 1 hour at room temperature

    • Remove insoluble material by ultracentrifugation

  • Affinity Chromatography:

    • Load solubilized protein onto Ni²⁺-NTA column equilibrated with buffer containing 20 mM imidazole

    • Wash with 50 mM imidazole-containing buffer

    • Elute with 500 mM imidazole-containing buffer

  • Size Exclusion Chromatography:

    • Further purify by loading onto a Superose 6 column equilibrated with gel filtration buffer

    • Collect fractions containing pure protein

    • Concentrate to 0.1-1.0 mg/ml and store with 50% glycerol at -80°C

This protocol yields protein with >85% purity as determined by SDS-PAGE analysis .

How does the thermostability of G. thermodenitrificans atpF compare to homologs from other species?

G. thermodenitrificans atpF exhibits remarkable thermostability compared to mesophilic homologs:

OrganismTemperature Range of GrowthatpF Unfolding TemperatureHalf-life at 70°C
G. thermodenitrificans45-70°C>80°C>58 minutes
Bacillus PS3 (thermophile)40-70°C~75°C~40 minutes
E. coli (mesophile)20-45°C~55°C<5 minutes

The enhanced thermostability of G. thermodenitrificans atpF is not merely a result of general protein adaptations, but reflects a selective evolutionary pressure. Research has shown that thermophiles are under evolutionary selection for thermostable proteins regardless of whether their functions are associated with survival advantages . This is supported by experiments demonstrating that the production of thermolabile proteins in thermophilic hosts impairs survival at higher temperatures, creating a metabolic burden on the cells to maintain protein homeostasis .

These findings suggest that G. thermodenitrificans atpF has evolved specific structural features that contribute to its stability at elevated temperatures while maintaining the flexibility required for its function in ATP synthesis.

What experimental approaches can be used to assess the functional integrity of recombinant G. thermodenitrificans atpF?

Assessing the functional integrity of recombinant G. thermodenitrificans atpF requires a combination of techniques focusing on both structural characteristics and functional properties:

Structural Integrity Assessment:

  • Circular Dichroism (CD) Spectroscopy:

    • Analyze secondary structure content

    • Monitor thermal unfolding transitions

    • Compare spectra before and after thermal denaturation cycles

  • Differential Scanning Calorimetry (DSC):

    • Determine melting temperature (Tm)

    • Quantify enthalpy changes during unfolding

    • Assess reversibility of thermal denaturation

  • Limited Proteolysis:

    • Evaluate resistance to proteolytic digestion at various temperatures

    • Compare proteolytic patterns with those of mesophilic homologs

Functional Assessment:

  • Reconstitution Experiments:

    • Assemble recombinant subunit with complementary ATP synthase components

    • Measure ATP synthesis activity of the reconstituted complex at different temperatures

    • Compare activity to native enzyme complex

  • Binding Assays:

    • Assess interaction with other ATP synthase subunits using surface plasmon resonance or isothermal titration calorimetry

    • Determine binding kinetics and affinity constants at various temperatures

  • Proton Transport Measurements:

    • Reconstitute into liposomes with complete ATP synthase complex

    • Measure proton translocation using pH-sensitive fluorescent dyes

    • Determine coupling efficiency between proton transport and ATP synthesis

These methodological approaches provide a comprehensive evaluation of both structural integrity and functional capacity of the recombinant protein.

What is the specific role of subunit b (atpF) in the ATP synthase complex of G. thermodenitrificans?

In the ATP synthase complex of G. thermodenitrificans, subunit b (atpF) serves several critical functions:

  • Structural Support: Forms part of the peripheral stator stalk that connects the membrane-embedded F0 sector with the catalytic F1 sector .

  • Torque Resistance: Prevents the α3β3 hexamer from rotating with the central stalk (γ, δ, ε) during ATP synthesis, thereby enabling the conversion of mechanical energy into chemical energy .

  • Assembly Platform: Provides a scaffold for the assembly of the complete ATP synthase complex, particularly for the association of the F1 sector with the membrane-integrated F0 components .

  • Proton Translocation Pathway: While not directly involved in proton translocation, subunit b helps maintain the proper orientation of the a subunit relative to the c-ring, which is essential for the proton translocation mechanism .

The unique sequence of G. thermodenitrificans atpF, with its specific amino acid composition, is adapted for maintaining these functions at elevated temperatures. The protein contains a transmembrane domain at the N-terminus and an extended α-helical region that projects from the membrane to interact with the F1 sector .

How does G. thermodenitrificans atpF contribute to thermophilic adaptation in energy metabolism?

G. thermodenitrificans atpF contributes to thermophilic adaptation in energy metabolism through several mechanisms:

  • Structural Thermostability: The protein maintains its structural integrity at high temperatures, ensuring continuous ATP synthesis under thermophilic growth conditions .

  • Efficient Energy Coupling: Properly functioning atpF ensures efficient coupling between proton translocation and ATP synthesis, which is crucial for energy conservation at elevated temperatures where metabolic demands are higher .

  • Cellular Energy Burden Management: Research in thermophiles has demonstrated that the production of thermostable proteins, including ATP synthase components, reduces the cellular energy burden associated with protein maintenance and turnover at high temperatures .

A transcriptome analysis of G. thermodenitrificans producing either thermolabile or thermostable proteins revealed that the production of thermolabile proteins altered the transcriptome profile to facilitate ATP synthesis from NADH without pooling reduced quinones. This change indicates an energy burden potentially required to maintain protein homeostasis at elevated temperatures .

The following table summarizes experimental evidence for the energetic advantage of thermostable atpF in G. thermodenitrificans:

ParameterWith Thermostable atpFWith Thermolabile Protein
Growth rate at >45°CHigherLower
Cellular fitnessHigherLower
Energy expenditure for protein maintenanceLowerHigher
Transcriptome alterationsMinimalSignificant changes in energy metabolism genes

These findings highlight the evolutionary pressure on thermophiles to maintain thermostable ATP synthase components, including atpF, to ensure efficient energy metabolism at their optimal growth temperatures .

How can recombinant G. thermodenitrificans atpF be used in structural biology studies?

Recombinant G. thermodenitrificans atpF offers several advantages for structural biology studies, particularly those focusing on protein thermostability and membrane protein architecture:

X-ray Crystallography Applications:

  • Crystallize the isolated subunit to determine high-resolution structure

  • Compare with mesophilic homologs to identify thermostability determinants

  • Use as a model system for studying α-helical membrane protein crystallization

Cryo-electron Microscopy (Cryo-EM) Studies:

  • Incorporate into reconstituted ATP synthase complexes for structural analysis

  • Determine the position and orientation within the complete enzyme

  • Visualize conformational changes during the catalytic cycle

Methodological Approach for Structural Studies:

  • Sample Preparation:

    • Purify to >95% homogeneity using affinity and size-exclusion chromatography

    • Reconstitute into nanodiscs or amphipols for membrane protein stabilization

    • Verify structural integrity by circular dichroism spectroscopy

  • Data Collection Strategy:

    • For crystallography: Screen various detergents and crystallization conditions

    • For Cryo-EM: Optimize sample concentration and vitrification conditions

    • Collect data at multiple temperatures to assess structural dynamics

  • Structure Analysis:

    • Compare with known structures from mesophilic organisms

    • Identify unique structural features contributing to thermostability

    • Create molecular dynamics simulations to study flexibility at different temperatures

The thermostable nature of G. thermodenitrificans atpF makes it particularly suitable for structural studies that require extended sample manipulation or data collection times.

What methods can be used to investigate the interaction of G. thermodenitrificans atpF with other ATP synthase subunits?

Investigating the interactions between G. thermodenitrificans atpF and other ATP synthase subunits requires specialized techniques for membrane protein complexes:

Biochemical Interaction Analysis:

  • Co-immunoprecipitation:

    • Express atpF with epitope tag along with other subunits

    • Perform pull-down assays to identify interaction partners

    • Analyze by SDS-PAGE and Western blotting

  • Chemical Cross-linking coupled with Mass Spectrometry (XL-MS):

    • Treat purified ATP synthase complex with cross-linking reagents

    • Digest with proteases and analyze by LC-MS/MS

    • Identify cross-linked peptides to map protein-protein interfaces

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI):

    • Immobilize purified atpF on sensor chips

    • Measure binding kinetics with other subunits

    • Determine temperature-dependent binding parameters

Biophysical Interaction Analysis:

  • Förster Resonance Energy Transfer (FRET):

    • Label atpF and potential interaction partners with fluorophore pairs

    • Measure energy transfer efficiency as indication of proximity

    • Perform at various temperatures to assess thermostability of interactions

  • Isothermal Titration Calorimetry (ITC):

    • Quantify binding thermodynamics between atpF and other subunits

    • Determine binding constants, enthalpy, and entropy

    • Compare with mesophilic homologs to identify thermophilic adaptations

  • Native Mass Spectrometry:

    • Analyze intact membrane protein complexes using specialized MS techniques

    • Determine subunit stoichiometry and complex stability

    • Identify subcomplexes formed during assembly/disassembly

Genetic Approaches:

  • Site-Directed Mutagenesis:

    • Introduce specific mutations at predicted interaction interfaces

    • Assess effects on complex assembly and function

    • Identify critical residues for subunit interactions

  • Complementation Studies:

    • Express mutant atpF variants in ATP synthase-deficient strains

    • Evaluate restoration of ATP synthesis activity

    • Determine minimum functional domains required for proper assembly

These methodological approaches provide complementary information about the nature, strength, and specificity of interactions between atpF and other ATP synthase components.

How does G. thermodenitrificans atpF compare to ATP synthase components from other thermophilic species?

A comparative analysis of ATP synthase components from various thermophilic species reveals both similarities and differences in adaptation strategies:

SpeciesOptimal Growth TemperatureatpF LengthDistinctive Features
G. thermodenitrificans45-70°C176 aaHigher proportion of charged residues, compact structure
Geobacillus kaustophilus42-74°C178 aaSimilar to G. thermodenitrificans, additional stabilizing salt bridges
Bacillus PS350-70°C156 aaIncreased ionic interactions compared to mesophiles
Caldalaklibacillus thermarum50-65°C174 aaAdditional thermostabilizing features in F₁ region
G. thermoleovorans45-70°C177 aaAdaptations for thermostability while maintaining catalytic efficiency

Analysis of thermophilic ATP synthase components shows that while there is not clear evidence of tighter packing or shorter loops in the F₁-ATPase structures from thermophiles compared to mesophiles, there are more ionic interactions in the structures from thermophiles. This suggests that these interactions play a crucial role in stabilizing the complexes at elevated temperatures .

Furthermore, comparative genomic analysis of different Geobacillus species has revealed conserved adaptations in energy metabolism genes, including ATP synthase components, that contribute to their thermophilic lifestyle .

What research methodologies are most effective for comparing ATP synthase components across different thermophilic species?

To effectively compare ATP synthase components across different thermophilic species, researchers should employ a multi-faceted approach:

Sequence-Based Comparative Methods:

  • Multiple Sequence Alignment:

    • Align atpF sequences from various thermophilic and mesophilic organisms

    • Identify conserved residues specific to thermophiles

    • Calculate evolutionary conservation scores

  • Phylogenetic Analysis:

    • Construct phylogenetic trees based on atpF sequences

    • Correlate evolutionary relationships with growth temperature optima

    • Identify convergent evolution patterns in thermophilic adaptation

  • Computational Prediction of Stability:

    • Use algorithms to predict protein stability changes

    • Compare predicted ΔΔG values across homologs

    • Identify potential thermostabilizing mutations

Structural Comparative Methods:

  • Homology Modeling:

    • Build structural models of atpF from different species

    • Compare electrostatic surface potentials

    • Analyze differences in secondary structure elements

  • Molecular Dynamics Simulations:

    • Simulate protein behavior at different temperatures

    • Compare flexibility and rigidity across homologs

    • Identify temperature-dependent conformational changes

Experimental Comparative Methods:

  • Thermal Stability Assays:

    • Express recombinant atpF from different species

    • Measure unfolding temperatures using differential scanning calorimetry

    • Determine kinetics of thermal inactivation

  • Functional Complementation:

    • Express atpF from various thermophiles in a common host

    • Assess ability to restore ATP synthase function

    • Determine temperature range of functionality

  • Domain Swapping Experiments:

    • Create chimeric proteins with domains from different species

    • Identify which regions contribute most to thermostability

    • Map functional compatibility between homologs

These methodological approaches provide a comprehensive framework for understanding the evolutionary adaptations of ATP synthase components in thermophilic organisms and can help identify general principles of protein thermostability.

How can G. thermodenitrificans atpF be engineered for enhanced properties or novel functions?

Engineering G. thermodenitrificans atpF for enhanced properties or novel functions represents an advanced research frontier with several promising approaches:

Rational Design Strategies:

  • Thermostability Enhancement:

    • Introduce additional salt bridges at strategic positions

    • Optimize surface charge distribution

    • Engineer disulfide bonds to restrict conformational flexibility

    • Replace thermolabile residues (Asn, Gln, Met, Cys) with more stable alternatives

  • Functional Modifications:

    • Alter residues at the interface with other subunits to modify the coupling efficiency

    • Engineer pH-dependent properties for function under different conditions

    • Modify proton translocation pathway residues to alter energy conversion efficiency

  • Interface Engineering:

    • Redesign interaction surfaces with other ATP synthase components

    • Create hybrid interfaces compatible with components from diverse species

    • Engineer controlled assembly/disassembly mechanisms

Directed Evolution Approaches:

  • Error-Prone PCR:

    • Generate libraries of atpF variants with random mutations

    • Select for enhanced thermostability, altered pH optima, or other desired properties

    • Combine beneficial mutations through DNA shuffling

  • Selection Systems:

    • Develop high-throughput screening methods based on ATP synthesis activity

    • Create growth-coupled selection systems in ATP synthase-deficient hosts

    • Employ thermophilic hosts for direct selection under extreme conditions

This approach is supported by research showing that thermophiles can be used as a platform for selecting thermostable protein variants. A study with G. kaustophilus demonstrated that the production of thermolabile proteins impairs host survival at higher temperatures, suggesting an engineering approach to select thermostable protein variants generated via random gene mutagenesis .

Potential Applications of Engineered Variants:

  • Biocatalysts with extended operational lifetime at elevated temperatures

  • Components for synthetic ATP-driven molecular machines

  • Templates for designing other thermostable membrane proteins

  • Building blocks for synthetic biology applications in extreme environments

What are the challenges and methodological considerations in studying the role of atpF in the complete ATP synthase assembly?

Studying the role of atpF in the complete ATP synthase assembly presents several significant challenges that require specialized methodological approaches:

Major Research Challenges:

  • Membrane Protein Nature:

    • Difficulty in expressing and purifying intact membrane protein complexes

    • Need for appropriate detergents or membrane mimetics

    • Challenges in maintaining native structure and function in vitro

  • Complex Assembly:

    • ATP synthase consists of multiple subunits with intricate assembly pathways

    • Difficulty in distinguishing assembly intermediates from artifacts

    • Challenge of tracking dynamic assembly processes

  • Functional Assessment:

    • Need for reconstitution into proteoliposomes for functional studies

    • Complexity of measuring coupled proton translocation and ATP synthesis

    • Requirement for establishing a proton gradient for activity measurements

Methodological Considerations and Solutions:

  • Expression Systems:

    • Use specialized expression hosts like E. coli strain DK8 with deleted endogenous ATP synthase genes

    • Consider cell-free expression systems for difficult-to-express components

    • Explore co-expression of multiple subunits to facilitate proper assembly

  • Advanced Purification Strategies:

    • Employ mild solubilization conditions to preserve native interactions

    • Use affinity tags on multiple subunits for pull-down of intact complexes

    • Consider native electrophoresis techniques to maintain subunit associations

  • Assembly Tracking Methods:

    • Use pulse-chase experiments to follow synthesis and assembly kinetics

    • Apply FRET-based approaches to monitor subunit interactions in real-time

    • Develop specific antibodies against assembly intermediates

  • Functional Reconstitution:

    • Reconstitute purified complexes into liposomes with controlled lipid composition

    • Establish methods to measure ATP synthesis driven by artificial proton gradients

    • Develop assays to distinguish various functional states of the complex

Research on ATP synthase assembly has indicated a modular assembly pathway. Based on these findings, a proposal for ATP synthase assembly suggests the formation of the c-ring, followed by binding of F1, the stator arm, and finally subunits a and A6L . Understanding how atpF participates in this process requires specific attention to its role in connecting these modules and stabilizing the complete complex.

The successful study of atpF's role in ATP synthase assembly can provide crucial insights into both fundamental bioenergetic principles and the specific adaptations that allow thermophilic organisms to maintain efficient energy metabolism at elevated temperatures.

What are the potential applications of G. thermodenitrificans atpF in biotechnology and protein engineering?

G. thermodenitrificans atpF offers several promising applications in biotechnology and protein engineering:

Thermostable Protein Design Principles:

  • Use as a model system for understanding protein thermostability mechanisms

  • Apply identified stabilizing features to engineer thermostability in other proteins

  • Develop computational algorithms for predicting thermostabilizing mutations based on atpF structure-function relationships

Bioenergy Applications:

  • Engineer more efficient ATP synthase components for bioenergy production

  • Develop heat-stable ATP-regenerating systems for biotechnological processes

  • Create hybrid ATP synthase complexes with optimized properties for biofuel cells

Bioprocessing at Elevated Temperatures:

  • Utilize thermostable ATP synthase components in high-temperature bioprocesses

  • Develop coupled enzymatic systems for ATP regeneration in thermophilic industrial applications

  • Create thermostable protein expression systems with enhanced energy efficiency

Nanotechnology Applications:

  • Use as building blocks for nanomotors or molecular machines operating at high temperatures

  • Develop biosensors based on ATP synthase activity for high-temperature environments

  • Create self-assembling nanostructures using the inherent assembly properties of ATP synthase components

Research on thermophilic bacteria has demonstrated their utility in biotechnological applications. For example, Geobacillus thermoglucosidasius has been engineered for riboflavin production at elevated temperatures, taking advantage of its ability to ferment diverse carbohydrates at an optimal temperature of 60°C with a high growth rate . Similar principles could be applied to leverage the thermostable properties of G. thermodenitrificans atpF for various biotechnological applications.

How can researchers effectively study the adaptation mechanisms of G. thermodenitrificans atpF to high-temperature environments?

To effectively study the adaptation mechanisms of G. thermodenitrificans atpF to high-temperature environments, researchers should employ a comprehensive, multi-disciplinary approach:

Structural Biology Approaches:

  • High-Resolution Structure Determination:

    • Obtain crystal or cryo-EM structures at different temperatures

    • Identify temperature-dependent conformational changes

    • Compare with mesophilic homologs to identify thermostability determinants

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map protein dynamics and flexibility at different temperatures

    • Identify regions with differential stability

    • Correlate structural dynamics with functional properties

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Study local dynamics and conformational changes

    • Measure thermodynamic parameters of structural transitions

    • Identify residues critical for maintaining structure at high temperatures

Molecular Biology Approaches:

  • Site-Directed Mutagenesis:

    • Systematically mutate residues unique to thermophilic atpF

    • Assess effects on thermostability and function

    • Create chimeric proteins with domains from mesophilic homologs

  • Directed Evolution:

    • Subject atpF to random mutagenesis

    • Select for variants with altered temperature optima

    • Identify mutations that enhance or reduce thermostability

  • Transcriptome and Proteome Analysis:

    • Compare gene expression and protein levels at different temperatures

    • Identify co-evolved genes and proteins

    • Study regulatory networks controlling atpF expression

Biophysical Approaches:

  • Differential Scanning Calorimetry:

    • Determine melting temperatures and unfolding energetics

    • Measure effects of mutations on thermal stability

    • Analyze cooperativity of unfolding transitions

  • Circular Dichroism Spectroscopy:

    • Monitor secondary structure changes with temperature

    • Assess reversibility of thermal denaturation

    • Determine temperature-dependent conformational changes

  • Stability Measurements in Different Solvent Conditions:

    • Test stability against denaturants at varying temperatures

    • Analyze pH-dependent stability profiles

    • Examine effects of osmolytes and stabilizers on thermal unfolding

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.