Recombinant Geobacillus thermodenitrificans Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; GTNG_1229; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Geobacillus thermodenitrificans (strain NG80-2)
Target Names
mscL
Target Protein Sequence
MWNEFKKFAIRGNVIDLAVGVIIGGAFGKIVSSLVNDIIMPLVGLLLGGIDFSNLSWKVG KAVVKYGAFIQTVVDFLIIAFSIFLFVKLINKLYERVKKQEEMEETEPTLTKEEELLTEI RDLLKQQRETM
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces within the lipid bilayer. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Why choose Geobacillus thermodenitrificans as a source organism for mscL proteins?

Geobacillus thermodenitrificans, like other thermophilic Bacillaceae, offers several advantages for studying mechanosensitive channels. As a thermophile with growth temperatures above 50°C, proteins derived from this organism are naturally thermostable, making them excellent candidates for structural and functional studies that require protein stability . The thermostability of G. thermodenitrificans proteins can facilitate crystallization and structural determination efforts, which are critical for understanding the molecular mechanisms of mechanosensitive channels. Additionally, thermophilic Bacillaceae share many favorable traits with Bacillus subtilis, including being non-pathogenic and free of exo- and endotoxins, which is particularly advantageous for studying proteins intended for potential therapeutic applications .

What are the key characteristics of mechanosensitive channels that must be preserved during recombinant expression?

Mechanosensitive channels like mscL function as pressure-relief valves, responding to membrane tension by opening pores that allow solutes to pass through the membrane. During recombinant expression, several critical features must be preserved:

  • Proper membrane insertion: As integral membrane proteins, mscL channels must be correctly inserted into the lipid bilayer to maintain function.

  • Oligomeric structure: The native oligomeric state (typically pentameric for mscL) must be maintained.

  • Tension sensitivity: The protein must retain its ability to respond to appropriate levels of membrane tension.

  • Conductance properties: The large-conductance characteristic must be preserved to ensure proper solute passage.

Expression systems must therefore provide appropriate membrane environments and post-translational processing. For G. thermodenitrificans mscL, expression at elevated temperatures (45-70°C) may be necessary to ensure proper folding and assembly, as these proteins have evolved to function optimally under thermophilic conditions .

How can the thermostability of G. thermodenitrificans mscL be leveraged for structural studies?

The thermostability of G. thermodenitrificans mscL can be strategically exploited for structural studies through several approaches:

  • Purification advantages: Thermostable proteins allow for heat-treatment steps during purification, where heating the cell lysate to 50-70°C can precipitate most host proteins while leaving the thermostable target protein in solution. This provides an additional purification step that can significantly increase purity with minimal loss of the target protein.

  • Crystallization benefits: Thermostable proteins typically demonstrate reduced conformational flexibility at room temperature, which can enhance crystallization success rates. The G. thermodenitrificans mscL, with its optimal temperature around 70°C (extrapolated from the L-glutaminase from the same organism ), may provide more rigid and homogeneous protein samples for crystallization attempts.

  • Cryo-EM applications: For single-particle cryo-electron microscopy, the increased rigidity of thermostable proteins can result in more consistent conformational states, potentially improving resolution of structural determinations.

  • Structural comparison methodology: Molecular docking and structural comparison techniques, as applied to G. thermodenitrificans L-glutaminase , can be extended to mscL. Despite potentially low sequence identity with mesophilic homologs, thermophilic proteins often maintain high structural conservation in functional domains. Servers like ConSurf and TM-align can identify evolutionarily conserved residues and structural domains, providing insights into the molecular basis of thermostability while maintaining mechanosensitive function .

What strategies can optimize heterologous expression of G. thermodenitrificans mscL in E. coli?

Optimizing heterologous expression of G. thermodenitrificans mscL in E. coli requires addressing several challenges specific to thermophilic membrane proteins:

  • Codon optimization: Adapting the G. thermodenitrificans mscL gene sequence to E. coli codon usage preferences while maintaining GC content appropriate for expression.

  • Expression vector selection: For initial expression trials, vectors with tight regulation are preferable. The pET system with T7 promoter allows controlled induction and has been successful for many membrane proteins.

  • Membrane targeting strategies:

    • Fusion with signal sequences known to direct inner membrane insertion

    • Co-expression with appropriate chaperones to facilitate membrane insertion

    • Testing different E. coli strains optimized for membrane protein expression (C41, C43)

  • Induction protocol optimization:

    ParameterTesting RangeRationale
    Temperature16-30°CLower temperatures slow folding, potentially improving membrane insertion
    Inducer concentration0.1-1.0 mM IPTGLower concentrations reduce expression rate, reducing aggregation
    Induction time3-24 hoursLonger times at lower temperatures may increase yield
    Media compositionLB, TB, M9Rich media provides components needed for membrane biogenesis
  • Solubilization screening: Test a panel of detergents for efficient extraction while maintaining protein stability and function:

    • Mild detergents (DDM, LMNG) for initial extraction

    • Shorter chain detergents for crystallization attempts

    • Amphipols or nanodiscs for functional studies

These approaches have been successfully employed for other challenging membrane proteins and can be adapted for G. thermodenitrificans mscL based on its thermophilic nature.

How can homologous expression systems in thermophilic Bacillaceae be developed for native-like production of mscL?

Developing homologous expression systems in thermophilic Bacillaceae requires a systematic approach to genetic tool development and expression optimization:

  • Vector construction: Utilize plasmids with demonstrated stability at thermophilic temperatures. The pNW33N shuttle vector has been successfully used in multiple thermophilic Bacillaceae at temperatures up to 55°C . Alternative vectors include pUB110-derivatives which have been functional in thermophilic hosts at 50-55°C .

  • Promoter selection: Several promoters have been characterized in thermophilic Bacillaceae:

    • Native G. thermodenitrificans promoters for consistent expression

    • Inducible promoters like the maltose-inducible promoter from B. methanolicus for controlled expression

    • Strong constitutive promoters from thermophilic phages for high-level expression

  • Secretion optimization: Thermophilic Bacillaceae possess efficient protein secretion systems that can be leveraged for membrane protein expression. Signal peptides have been successfully exchanged between different Bacillus species . A modular system developed for G. thermoglucosidasius allows easy exchange of promoters, signal peptides, and genes of interest to optimize expression and membrane insertion efficiency .

  • Expression protocol development:

    ParameterConsideration
    Growth temperature50-70°C depending on optimal growth of host strain
    Media compositionComplex media with appropriate carbon sources (glucose, xylose)
    Induction timingMid-logarithmic phase for maximum expression efficiency
    Cultivation modeFed-batch cultivation to reach high cell densities (OD600 >10)
  • Membrane fraction isolation: Thermophilic cells have distinct membrane composition adapted to high temperatures, requiring optimization of membrane isolation protocols specific to thermophilic Bacillaceae.

This approach takes advantage of the natural thermophilic environment of G. thermodenitrificans, potentially resulting in more native-like conformation and function of the expressed mscL protein.

What are the key considerations for designing functional assays for recombinant G. thermodenitrificans mscL?

Designing functional assays for recombinant G. thermodenitrificans mscL requires special considerations for a thermostable mechanosensitive channel:

  • Temperature-dependent activity assessment:

    • Assays should be conducted at temperatures ranging from 30°C to 70°C to determine optimal functional temperature

    • Temperature stability testing to determine if activity is maintained after heat treatment

    • Control experiments with mesophilic mscL homologs to benchmark temperature-dependent differences

  • Patch-clamp electrophysiology adaptations:

    • Heat-stable recording chambers capable of maintaining elevated temperatures

    • Temperature control systems with precision of ±0.5°C

    • Detergent selection that maintains stability at higher temperatures

    • Membrane composition adjustments to mimic thermophilic membranes (higher proportion of saturated lipids)

  • Osmotic shock survival assays:

    • Complementation of mscL-deficient E. coli strains with G. thermodenitrificans mscL

    • Downshock experiments at varied temperatures to assess temperature-dependent protection

    • Quantification of survival rates using the following protocol:

      StepProcedureCritical Parameters
      1Pre-culture in high osmolarity mediaLB + 500 mM NaCl
      2Harvest cells in mid-log phaseOD600 0.4-0.6
      3Dilute cells in low osmolarity mediaLB without NaCl
      4Plate serial dilutionsPre-warm plates to appropriate temperature
      5Quantify survivalCalculate survival percentage compared to control
  • Fluorescence-based tension sensing:

    • Reconstitution in liposomes with tension-sensitive fluorescent dyes

    • Micropipette aspiration of giant unilamellar vesicles (GUVs) containing mscL

    • Temperature-controlled microscopy setup for real-time imaging during tension application

  • Structure-function relationship investigations:

    • Site-directed mutagenesis of conserved residues identified through bioinformatic analysis

    • Comparative analysis with mesophilic homologs to identify thermostability determinants

    • Correlation of structural features with functional parameters at different temperatures

These methodological approaches should be adapted for the thermophilic nature of G. thermodenitrificans proteins, with particular attention to maintaining appropriate conditions throughout the experimental procedures.

How can recombinant G. thermodenitrificans mscL be purified while maintaining structural integrity?

Purification of recombinant G. thermodenitrificans mscL requires a carefully designed protocol to maintain structural integrity of this thermophilic membrane protein:

  • Initial extraction optimization:

    • Membrane isolation using differential centrifugation following cell disruption

    • Heat treatment (50-60°C for 10-20 minutes) to precipitate mesophilic host proteins when expressed in E. coli

    • Detergent screening panel with emphasis on maltoside-based detergents (DDM, LMNG) known to maintain membrane protein structure

  • Multi-step purification strategy:

    Purification StepMethodParametersCritical Considerations
    Affinity ChromatographyIMAC (His-tag)50 mM Tris pH 8.0, 150 mM NaCl, 0.05% DDMMaintain detergent above CMC throughout
    Size ExclusionSuperdex 200PBS pH 7.4, 0.03% DDMAssess oligomeric state preservation
    Ion Exchange (optional)Q or S Sepharose20 mM HEPES pH 7.5, 0-500 mM NaCl gradientRemove remaining contaminants
  • Stability assessment during purification:

    • Thermal stability assays at each purification stage using differential scanning fluorimetry

    • Monitoring oligomeric state using blue native PAGE or analytical ultracentrifugation

    • Limited proteolysis to identify flexible regions and confirm compact folding

  • Reconstitution methods:

    • Incorporation into nanodiscs or amphipols for improved stability

    • Liposome reconstitution using lipid compositions mimicking thermophilic membranes

    • Detergent removal via Bio-Beads or dialysis with careful temperature control

  • Quality control metrics:

    • Homogeneity assessment via dynamic light scattering

    • Functional verification using planar lipid bilayer conductance measurements

    • Structural integrity verification via negative-stain electron microscopy

Purification protocols should build upon approaches used for other thermophilic proteins from G. thermodenitrificans, such as the L-glutaminase which was purified to electrophoretic homogeneity with 40% recovery and 22.36-fold purity enhancement . The thermostability of G. thermodenitrificans mscL can be leveraged during purification by incorporating heat treatment steps that selectively denature contaminating proteins while preserving the target protein.

What molecular biology techniques are most effective for cloning and mutagenesis studies of G. thermodenitrificans mscL?

Effective molecular biology techniques for cloning and mutagenesis of G. thermodenitrificans mscL should account for the high GC content and thermophilic origin of the gene:

  • Optimal cloning strategies:

    • Gene synthesis with codon optimization for the expression host

    • Use of high-fidelity polymerases with enhanced capability for GC-rich templates (Q5, Phusion)

    • Addition of DMSO (5-10%) or betaine (1-2 M) to PCR reactions to reduce secondary structure formation

    • Two-step PCR protocols with higher denaturation temperatures (98°C) for efficient template melting

  • Vector selection criteria:

    • For E. coli expression: pET vectors with T7 promoter for high-level controlled expression

    • For Bacillaceae expression: shuttle vectors with demonstrated thermostability such as pNW33N or pUB110-derivatives

    • Incorporation of thermostable selection markers (e.g., chloramphenicol acetyl transferase from S. aureus)

  • Mutagenesis approaches:

    TechniqueApplicationAdvantages for G. thermodenitrificans mscL
    Site-directed mutagenesisSingle residue changesAllows systematic analysis of conserved residues
    Domain swappingChimeric proteinsIdentifies thermostability determinants
    Deletion analysisFunctional domain mappingDetermines minimal functional units
    Random mutagenesisDirected evolutionCan identify unexpected functional residues
    CRISPR/Cas9Genomic integrationRecently deployed in thermophilic Bacillaceae
  • Verification methods:

    • Sequencing with optimized protocols for GC-rich regions

    • Restriction mapping with thermostable restriction enzymes

    • Colony PCR adapted for thermophilic organisms (higher lysis and denaturation temperatures)

  • Expression screening approaches:

    • Small-scale expression tests with different constructs in parallel

    • Western blotting with anti-His or custom antibodies against conserved mscL epitopes

    • Fluorescence-based screens using GFP fusions to assess membrane localization

These techniques build upon successful approaches for other thermophilic proteins and leverage the recent advances in genetic tools for thermophilic Bacillaceae. The application of CRISPR/Cas9 technologies, which have been successfully deployed in several thermophilic Bacillaceae species , offers particular promise for genomic integration and advanced mutagenesis studies of G. thermodenitrificans mscL.

How should electrophysiological data from G. thermodenitrificans mscL be analyzed to account for temperature effects?

Electrophysiological data analysis for G. thermodenitrificans mscL requires special considerations to account for temperature effects:

  • Temperature correction of biophysical parameters:

    • Conductance measurements must be normalized according to the Arrhenius equation to account for temperature-dependent changes in ion mobility

    • Gating tension thresholds should be analyzed with membrane fluidity considerations at different temperatures

    • Kinetic parameters (opening/closing rates) require temperature coefficient (Q10) calculations

  • Data normalization protocol:

    ParameterNormalization MethodCalculation
    Single channel conductanceTemperature-corrected Ohm's lawG(T) = G(ref) × exp[Ea/R × (1/Tref - 1/T)]
    Gating tension thresholdMembrane elastic moduli correctionτ(T) = τ(ref) × [KA(T)/KA(ref)]
    Channel kineticsQ10 calculationQ10 = (Rate at T+10°C)/(Rate at T°C)
  • Comparative analysis framework:

    • Direct comparison with mesophilic mscL homologs at their respective physiological temperatures

    • Establishment of temperature-activity profiles (30-80°C) to identify optimal functional temperature

    • Assessment of hysteresis effects through temperature ramping experiments (heating vs. cooling)

  • Lipid-protein interaction analysis:

    • Correction for lipid phase transitions at different temperatures

    • Consideration of lipid bilayer thickness changes with temperature

    • Analysis of hydrophobic mismatch effects at different temperatures

  • Statistical approaches for temperature-dependent data:

    • ANCOVA with temperature as covariate for multi-temperature comparisons

    • Non-linear regression to determine activation energies for channel opening

    • Boltzmann distribution analysis to calculate entropy and enthalpy components of channel gating

By applying these analytical approaches, researchers can distinguish intrinsic properties of G. thermodenitrificans mscL from temperature-induced effects, allowing meaningful comparisons with mesophilic homologs and providing insights into thermoadaptation of mechanosensitive channel function.

What in silico approaches can predict structural features of G. thermodenitrificans mscL?

In silico approaches for predicting structural features of G. thermodenitrificans mscL should leverage both sequence-based and structure-based computational methods:

  • Homology modeling workflow:

    • Template identification using HHpred or BLAST against PDB

    • Multiple sequence alignment with thermophilic and mesophilic mscL homologs

    • Model building using Swiss-Model or Rosetta membrane protein modeling suite

    • Model refinement with molecular dynamics simulations at elevated temperatures (50-70°C)

    • Quality assessment using ProCheck, QMEAN, and MolProbity metrics

  • Thermostability prediction methods:

    • Analysis of amino acid composition biases characteristic of thermophilic proteins

    • Identification of stabilizing salt bridge networks using ESBRI server

    • Calculation of ΔΔG for thermostabilizing mutations using FoldX or Rosetta

    • Rigidity analysis using constrained geometric simulations

  • Functional domain identification:

    Analysis MethodApplicationExpected Outcome
    ConSurf analysisEvolutionary conservation mappingIdentification of functionally critical residues
    TM-alignStructural alignment with homologsQuantification of structural conservation despite sequence divergence
    Molecular dockingSubstrate/inhibitor binding predictionIdentification of potential binding sites and interacting residues
    Elastic network modelsConformational dynamics predictionIdentification of functionally relevant motion modes
  • Membrane interaction analysis:

    • Hydropathy profiling with thermophilic-specific scales

    • Prediction of membrane insertion energetics using PPM server

    • Analysis of lipid-facing residues and their thermophilic adaptations

    • Coarse-grained MD simulations to assess protein-membrane interactions at different temperatures

  • Integration with experimental data:

    • Iterative refinement of models based on mutation effects

    • Validation against limited proteolysis or HDX-MS data

    • Cross-validation against functional electrophysiology measurements

These computational approaches, similar to those successfully applied to G. thermodenitrificans L-glutaminase , can provide valuable insights into the structural basis of thermostability and mechanosensitive function of G. thermodenitrificans mscL, guiding experimental design and interpretation.

How can researchers reconcile potential differences between heterologous and homologous expression data for G. thermodenitrificans mscL?

Reconciling differences between heterologous and homologous expression data for G. thermodenitrificans mscL requires systematic comparison and careful analysis:

  • Systematic comparison methodology:

    • Standardized purification and characterization protocols across expression systems

    • Side-by-side functional assays under identical conditions

    • Detailed characterization of post-translational modifications from each system

    • Structural analysis to identify conformational differences

  • Key parameters for comparison:

    ParameterAnalysis ApproachSignificance
    Protein yieldQuantification per liter of cultureEconomic feasibility assessment
    Functional activityNormalized activity per mg proteinQualitative assessment of proper folding
    Oligomeric stateBN-PAGE or SEC-MALSVerification of correct assembly
    Thermal stabilityDSF or circular dichroismAssessment of proper thermostable conformation
    Post-translational modificationsMass spectrometryIdentification of system-specific modifications
  • Membrane environment considerations:

    • Lipidomic analysis of membrane composition in different expression hosts

    • Reconstitution experiments in defined lipid environments to normalize comparison

    • Assessment of membrane thickness and fluidity at different temperatures

    • Analysis of detergent effects on protein structure and function

  • Interpretation framework:

    • Identification of expression system artifacts versus genuine protein properties

    • Determination of minimum requirements for functional expression

    • Establishment of a decision tree for choosing appropriate expression system based on research goals

    • Development of correction factors to normalize data across expression systems

  • Integration strategies:

    • Multi-system validation of critical findings

    • Complementary use of different systems for specific applications (e.g., E. coli for high-throughput mutagenesis, thermophilic hosts for detailed functional studies)

    • Machine learning approaches to identify patterns in cross-system variability

    • Meta-analysis of multiple datasets to extract system-independent protein characteristics

This systematic approach allows researchers to distinguish inherent properties of G. thermodenitrificans mscL from expression system artifacts, providing a more complete understanding of this thermophilic mechanosensitive channel and establishing best practices for future studies.

What are common pitfalls in recombinant expression of G. thermodenitrificans mscL and how can they be addressed?

Recombinant expression of G. thermodenitrificans mscL presents several potential challenges that can be systematically addressed:

  • Low expression levels:

    • Cause: Codon usage bias, toxic effects, or improper promoter strength

    • Solution: Codon optimization, use of tightly regulated promoters, expression as fusion protein with solubility tags, or use of specialized strains like C41(DE3) designed for toxic membrane proteins

  • Inclusion body formation:

    • Cause: Rapid expression rate exceeding membrane insertion capacity

    • Solution: Lower induction temperature (16-30°C), reduce inducer concentration, use slower promoters, co-express with chaperones like DnaK/DnaJ system

  • Proteolytic degradation:

    • Cause: Improperly folded protein targeted by host proteases

    • Solution: Use of protease-deficient strains, addition of protease inhibitors, optimization of harvest timing, fusion with stabilizing domains

  • Plasmid instability in thermophilic hosts:

    • Cause: Replication machinery failure at elevated temperatures

    • Solution: Use of plasmids with thermostable replicons like those derived from pNW33N or pUB110, both demonstrated to function at temperatures above 50°C

  • Troubleshooting decision tree:

    IssueDiagnostic TestPrimary InterventionSecondary Intervention
    No expressionWestern blot of whole cellsChange expression vectorTry different host strain
    Insoluble proteinMembrane fractionationLower expression temperatureOptimize detergent extraction
    Inactive proteinFunctional assayAdjust membrane mimeticTest different purification methods
    Unstable proteinThermal shift assayAdd stabilizing additivesEngineer stabilizing mutations
    Incorrect oligomerizationBN-PAGE analysisAdjust detergent typeModify purification protocol
  • Expression host-specific optimizations:

    • For E. coli: Testing of specialized strains (BL21, C41/C43, Lemo21)

    • For B. subtilis: Use of protease-deficient strains

    • For thermophilic Bacillaceae: Optimization of culture media composition and growth temperature

By implementing these troubleshooting strategies, researchers can overcome common obstacles in the recombinant expression of G. thermodenitrificans mscL and achieve sufficient quantities of properly folded, functional protein for structural and functional studies.

How can researchers validate that recombinant G. thermodenitrificans mscL retains native-like structure and function?

Validating native-like structure and function of recombinant G. thermodenitrificans mscL requires a multi-faceted approach:

These validation approaches provide complementary lines of evidence for native-like structure and function, increasing confidence that the recombinant G. thermodenitrificans mscL accurately represents the native protein. The multi-parameter assessment is especially important for membrane proteins, which are particularly sensitive to their lipid environment and expression conditions.

What strategies can resolve protein aggregation issues during expression or purification of G. thermodenitrificans mscL?

Resolving protein aggregation issues for G. thermodenitrificans mscL requires a comprehensive approach targeting each stage of expression and purification:

  • Prevention strategies during expression:

    • Reduce expression rate through lower inducer concentration and temperature

    • Co-express with chaperone systems (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Utilize fusion partners known to enhance membrane protein folding (Mistic, SUMO)

    • Employ specialized expression strains with altered membrane composition

    • Optimize growth media with supplementation of specific lipids

  • Membrane extraction optimization:

    • Systematic detergent screening with focus on mild detergents:

      Detergent ClassExamplesStarting ConcentrationBenefits
      MaltosideDDM, UDM1-2%Gentle extraction, maintains oligomeric state
      GlucosideOG, NG1-2%Better for crystallization, shorter chain
      Neopentyl glycolLMNG, DMNG0.5-1%Enhanced stability, low CMC
      ZwitterionicFC-12, LDAO0.5-1%Efficient solubilization, may destabilize
    • Extraction temperature optimization (room temperature vs. elevated temperature)

    • Addition of stabilizing agents during extraction (glycerol, specific lipids)

    • pH optimization to minimize aggregation propensity

  • Purification modifications:

    • Inclusion of high salt concentration (300-500 mM) to reduce non-specific interactions

    • Addition of mild solubilizing agents (arginine, proline)

    • Implementation of size exclusion chromatography as first purification step

    • Density gradient centrifugation to separate aggregates from properly folded protein

    • On-column refolding protocols with decreasing concentration of chaotropic agents

  • Alternative solubilization approaches:

    • Amphipol exchange for enhanced stability post-purification

    • Nanodisc reconstitution with optimized lipid composition

    • Styrene maleic acid lipid particles (SMALPs) for native-like membrane environment

    • Novel polymer-based solubilization systems (e.g., diisobutylene maleic acid)

  • Biophysical characterization of aggregation:

    • Dynamic light scattering to monitor aggregation state during purification

    • Analytical ultracentrifugation to quantify oligomeric distribution

    • Thermal stability assays to identify stabilizing conditions

    • Systematic analysis of buffer components affecting aggregation propensity

By implementing these strategies in a systematic manner, researchers can identify conditions that minimize aggregation while maximizing yield of functional G. thermodenitrificans mscL. The thermophilic nature of this protein may actually provide advantages once properly folded, as thermostable proteins often demonstrate enhanced resistance to aggregation under properly optimized conditions.

How can structural insights from G. thermodenitrificans mscL inform the engineering of mechanosensitive channels for biotechnological applications?

Structural insights from G. thermodenitrificans mscL can drive innovative engineering approaches for biotechnological applications:

  • Thermostability engineering platform:

    • Identification of thermostabilizing residues and motifs through comparative analysis with mesophilic homologs

    • Creation of chimeric channels combining thermostable domains with functional domains from mesophilic channels

    • Development of a modular design framework for introducing thermostability into other membrane proteins

  • Gating mechanism modifications:

    • Engineering of tension sensitivity through targeted mutations of transmembrane domains

    • Creation of channels with altered gating thresholds for specific applications

    • Development of channels responsive to alternative stimuli (pH, light, ligands) by incorporating sensing domains

  • Biotechnological application pathways:

    Application AreaEngineering ApproachPotential Benefit
    BiosensorsCoupling channel gating to reporter systemsHighly sensitive tension measurement in biological systems
    Controlled release systemsEngineering stimulus-responsive channelsThermally triggered release of encapsulated compounds
    BioremediationAdaptation for toxic compound exportEnhanced survival of engineered organisms in contaminated environments
    Biofuel productionOptimized efflux of inhibitory compoundsImproved tolerance to toxic metabolites in biofuel-producing strains
  • Translational medicine applications:

    • Development of thermostable mechanosensitive channels for integration into artificial tissues

    • Creation of drug delivery systems utilizing mechanical tension for controlled release

    • Engineering of mechanosensitive channels for use in high-temperature industrial processes

  • Directed evolution platforms:

    • Establishment of selection systems based on mechanosensitive channel function

    • Development of high-throughput screening methods for channel variants

    • Creation of evolutionary trajectories for channel specialization

These engineering approaches leverage the unique structural features of G. thermodenitrificans mscL, particularly its thermostability and mechanosensitive properties, to develop novel biotechnological tools and applications. The integration of computational design with experimental validation allows for rational engineering of channels with specific properties tailored to diverse applications.

What comparative insights can be gained by studying mechanosensitive channels across thermophilic and mesophilic organisms?

Comparative analysis of mechanosensitive channels from thermophilic and mesophilic organisms provides valuable insights into evolution, adaptation, and fundamental biophysical principles:

  • Evolutionary adaptation mechanisms:

    • Identification of conserved structural elements essential for mechanosensation regardless of thermal environment

    • Elucidation of adaptive changes that maintain function across temperature ranges

    • Analysis of evolutionary trajectories leading to thermostabilization while preserving mechanosensitive function

  • Structure-function relationship insights:

    • Determination of how thermophilic adaptations affect tension sensing mechanisms

    • Understanding of the balance between structural rigidity needed for thermostability and flexibility required for channel gating

    • Identification of structurally divergent but functionally convergent solutions to mechanosensation

  • Membrane-protein interaction patterns:

    ParameterThermophilic AdaptationFunctional Consequence
    Membrane compositionIncreased saturation, longer acyl chainsAltered hydrophobic matching requirements
    Interfacial residuesEnhanced hydrophobicity, reduced flexibilityModified membrane-protein coupling
    Lipid-binding sitesMore specific lipid-protein interactionsTemperature-dependent regulation mechanisms
    Lateral pressure profileAdaptation to altered membrane physicsRecalibrated tension sensing thresholds
  • Biophysical principles extraction:

    • Quantification of temperature effects on channel gating energetics

    • Determination of entropy-enthalpy compensation mechanisms in channel function

    • Understanding of how protein dynamics scales with temperature while maintaining consistent function

  • Ecological and physiological context:

    • Correlation of channel properties with environmental niches

    • Assessment of how mechanosensitive channels contribute to stress responses across temperature ranges

    • Understanding of osmoregulation mechanisms in different thermal environments

This comparative approach, similar to analyses done for other thermophilic proteins like the G. thermodenitrificans L-glutaminase , provides fundamental insights that extend beyond the specific proteins studied. By identifying how nature solves the challenge of maintaining mechanosensitive function across diverse thermal environments, researchers can extract principles applicable to protein engineering, synthetic biology, and understanding of membrane protein evolution.

How might G. thermodenitrificans mscL be utilized in high-temperature biosensing applications?

G. thermodenitrificans mscL offers unique properties that can be leveraged for high-temperature biosensing applications:

  • Thermostable tension biosensor design:

    • Integration with fluorescent reporter systems stable at elevated temperatures

    • Development of FRET-based tension sensors using thermostable fluorescent proteins

    • Creation of electrical biosensors utilizing channel conductance as the readout

    • Engineering of cell-based biosensors for industrial bioprocess monitoring

  • High-temperature application advantages:

    • Reduced risk of microbial contamination in industrial settings

    • Enhanced reaction kinetics and diffusion rates

    • Compatibility with industrial processes operating at elevated temperatures

    • Reduced cooling requirements for industrial bioprocessing

  • Biosensor implementation approaches:

    Sensing ModalityImplementation StrategyPotential Applications
    ElectricalChannel reconstitution in supported bilayersIndustrial pressure monitoring
    OpticalFRET-based conformational change detectionReal-time tension measurement in high-temperature processes
    MechanicalAtomic force microscopy with functionalized tipsSingle-molecule force sensing
    Cell-basedEngineered thermophilic bacteria with reporter systemsBioprocess monitoring in biofuel production
  • Specific applications in industrial biotechnology:

    • Monitoring of membrane integrity in thermophilic fermentation processes

    • Detection of osmotic and mechanical stress in high-temperature bioreactors

    • Sensing of solvent stress in thermophilic biofuel production

    • Measurement of mechanical properties in thermostable materials development

  • Integration with other sensing systems:

    • Multi-parametric sensing combining tension with temperature, pH, or specific molecules

    • Development of logic gates based on mechanosensitive channels for complex sensing

    • Creation of feedback systems for bioprocess control

The implementation of G. thermodenitrificans mscL in high-temperature biosensing applications takes advantage of its natural thermostability while leveraging its mechanosensitive properties. This provides unique capabilities for biosensing in extreme environments where conventional protein-based sensors would fail due to thermal denaturation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.