NADH-quinone oxidoreductase subunit A (nuoA) is a component of the NADH:quinone oxidoreductase I (NDH-1) complex, an enzyme that catalyzes the transfer of electrons from NADH to quinones in the respiratory chain . NDH-1 contributes to the generation of a proton electrochemical gradient across the cytoplasmic membrane . In Geobacillus thermodenitrificans, nuoA is essential for the function of the NDH-1 complex.
NADH-quinone oxidoreductase subunit A (nuoA) is involved in oxidoreductase activity, acting on NADH or NADPH . NDH-1 transports electrons from NADH, using flavin mononucleotide (FMN) and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain . Ubiquinone is thought to be the direct electron acceptor for the enzyme in this species . The redox reaction is coupled to proton translocation, where four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, which conserves the redox energy in a proton gradient .
The gene name for NADH-quinone oxidoreductase subunit A is nuoA . Synonyms for nuoA include GTNG_3302, NADH dehydrogenase I subunit A, NADH-quinone oxidoreductase subunit A, NDH-1 subunit A, and NUO1 . In Escherichia coli, the gene nuoF encodes for the polypeptide NADH:quinone oxidoreductase subunit F .
Recombinant Full Length Geobacillus thermodenitrificans NADH-quinone oxidoreductase subunit A(nuoA) Protein, His-Tagged is a protein expressed in E. coli . It is fused to an N-terminal His tag and has a full length of 1-122 amino acids . The amino acid sequence is: MSNIYANSYLIVFVFLCLGVLLPIGALTIGRWLRPNVPDEAKATTYESGNIPFHDSRIQF QVRYYLFALLFVIFDVETVFLYPWAVVYDQLGLFALVEMIIFIVLLAIGLIYAWKKKVLR WM . The protein's purity is greater than 90% as determined by SDS-PAGE .
Methanothermobacter marburgensis possesses a gene (Gene ID 9704440) that encodes for a putative NAD(P)H:quinone oxidoreductase, referred to as MmNQO . MmNQO is a flavin-dependent NADH:quinone oxidoreductase capable of oxidizing NADH in the presence of various electron acceptors, while NADPH oxidation occurs with a smaller subset of acceptors . The enzyme is a homodimer, with each monomer consisting of 196 residues folded into flavodoxin-like α/β domains with non-covalently bound FMN .
Recombinant His6-tagged MmNQO was purified to homogeneity, with an apparent molecular weight of approximately 24,000 Da as determined by SDS-PAGE, consistent with the theoretical molecular weight of 23,538 Da . The purified MmNQO was tested for NADH:quinone oxidoreductase activity using NADH or NADPH as electron donors and various electron acceptors . With NADH, MmNQO exhibited activity with all electron acceptors tested, whereas NADPH was oxidized with fewer electron acceptors, typically showing 2- to 20-fold lower activity compared to NADH . The highest specific activity was observed with NADH and Ferrocenium hexafluorophosphate as the electron acceptor .
KEGG: gtn:GTNG_3302
STRING: 420246.GTNG_3302
Geobacillus thermodenitrificans is a rod-shaped, Gram-positive thermophilic bacterium capable of growth between 45-70°C under neutral pH conditions . As a thermophile, its proteins have evolved structural adaptations for thermal stability, making them valuable for industrial and research applications requiring robust enzymatic activity at elevated temperatures. Geobacillus thermodenitrificans IBRL-nra strain has been extensively studied, particularly for its thermostable enzymes that maintain functionality under extreme conditions .
The nuoA protein from Geobacillus thermodenitrificans shows structural characteristics typical of thermophilic proteins compared to mesophilic counterparts. The thermostable nature of proteins from this organism generally results from increased hydrophobic interactions, additional salt bridges, and more compact folding that together enhance stability at elevated temperatures. The nuoA protein specifically contains 122 amino acids, predominantly hydrophobic residues, which is consistent with its membrane-associated function in the NADH dehydrogenase complex . While mesophilic homologs maintain similar core functional domains, they typically contain fewer stabilizing features and may denature at temperatures where the Geobacillus protein remains fully functional.
The optimal expression system for recombinant Geobacillus thermodenitrificans nuoA protein is Escherichia coli with a His-tag fusion . This system offers several methodological advantages:
Vector design: Use of vectors containing T7 promoter systems compatible with His-tag fusion proteins
Expression conditions: Induction at lower temperatures (25-30°C) despite the thermophilic origin of the protein
Fusion structure: N-terminal His-tag placement to facilitate purification while minimizing interference with protein folding
The E. coli expression system provides sufficient yields while maintaining proper folding of the thermostable protein. For researchers working with membrane proteins like nuoA, specialized E. coli strains such as C41(DE3) or C43(DE3) may offer improved expression of potentially toxic membrane proteins .
The recommended purification protocol leverages the His-tag fusion design and includes the following methodological steps:
Cell lysis: Sonication in a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and 10 mM imidazole
Initial clarification: Centrifugation at 10,000 g for 30 minutes to remove cell debris
Membrane protein solubilization: Treatment with 1% detergent (typically n-dodecyl-β-D-maltoside)
Affinity chromatography: Nickel-NTA column with washing using 20 mM imidazole and elution with 250 mM imidazole
Buffer exchange: Dialysis against a storage buffer containing 20 mM Tris-HCl (pH 8.0), 150 mM NaCl, and 6% trehalose
Quality control: SDS-PAGE verification achieving >90% purity
After purification, the protein should be stored as specified in section 2.3 to maintain stability and activity.
The optimal storage conditions for preserving nuoA protein activity are:
| Storage Parameter | Recommended Condition | Notes |
|---|---|---|
| Form | Lyophilized powder | Maximizes long-term stability |
| Short-term storage | 4°C | For working aliquots (up to one week) |
| Long-term storage | -20°C to -80°C | Aliquoting necessary to avoid freeze-thaw cycles |
| Buffer composition | Tris/PBS-based buffer with 6% trehalose, pH 8.0 | Trehalose acts as a cryoprotectant |
| Reconstitution | Deionized sterile water to 0.1-1.0 mg/mL | Add 5-50% glycerol (final concentration) |
| Freeze-thaw cycles | Avoid repeated cycles | Significantly reduces protein activity |
Researchers should centrifuge the vial briefly before opening to bring contents to the bottom and prepare small working aliquots to minimize freeze-thaw cycles .
Researchers studying nuoA protein activity across temperature ranges should implement the following experimental design optimizations:
Model parameter resolution: Define temperature-dependent variables that could affect protein activity and stability through preliminary testing
Non-linear response modeling: As enzyme kinetics often follow non-linear relationships, apply global optimization theory to examine how temperature affects activity patterns
Robustness implementation: Design experiments that are relatively immune to potential bias errors by:
Reference points: Include both Geobacillus thermodenitrificans lipase activity points (which function optimally at 65°C) and mesophilic homologs to provide comparative benchmarks
This approach treats experimental design as an iterative exercise in hypothesis testing, allowing researchers to delineate critical data ranges that are most important for resolving the temperature-dependent activity model .
When designing substrate specificity experiments for nuoA, researchers should consider the following methodological approaches:
Substrate panel design: Create a diverse substrate panel including:
Natural NADH substrates with varying chain lengths and modifications
Synthetic analogs with systematic structural variations
Competitive inhibitors to probe binding site characteristics
Experimental controls:
Positive controls using known high-affinity substrates
Negative controls with structurally dissimilar molecules
Parallel testing with well-characterized homologous proteins
Detection methodologies:
Spectrophotometric assays monitoring NADH oxidation at 340 nm
Oxygen consumption measurements for complete electron transfer chains
Coupled enzyme assays for indirect activity detection
Statistical design principles:
This comprehensive approach ensures robust characterization of substrate specificity while minimizing experimental artifacts.
Researchers can integrate molecular dynamics (MD) simulations with experimental data for nuoA through the following methodological framework:
Structure preparation:
Simulation parameterization informed by experiments:
Set temperature parameters to match experimental conditions (45-70°C range)
Include appropriate membrane models to simulate the native environment
Incorporate experimental binding affinity data to validate force field parameters
Iterative refinement process:
Run initial simulations and compare predicted conformational changes with experimental observables
Refine models based on discrepancies between simulation and experiment
Implement bias-exchange metadynamics to enhance sampling of rare conformational states
Experimental validation of simulation predictions:
Design site-directed mutagenesis experiments targeting residues identified in simulations
Conduct spectroscopic experiments (circular dichroism, fluorescence) to validate predicted structural changes
Perform functional assays to correlate structural predictions with activity measurements
This integrated approach allows researchers to overcome limitations of both computational and experimental techniques in isolation .
Researchers analyzing kinetic data for thermostable nuoA versus mesophilic homologs should employ the following analytical framework:
Temperature-normalized comparisons:
Plot relative activity (percentage of maximum) versus temperature for both protein types
Calculate temperature optima (Topt) and temperature range breadth (T90, range where activity exceeds 90% of maximum)
Apply Arrhenius plots to extract activation energies (Ea) and identify temperature breakpoints
Thermodynamic parameter extraction:
Calculate ΔH‡, ΔS‡, and ΔG‡ values using transition state theory equations
Compare entropy-enthalpy compensation between thermophilic nuoA and mesophilic homologs
Construct temperature-dependent free energy diagrams to visualize stability differences
Statistical analysis methods:
Apply non-linear regression to fit enzyme kinetic models (Michaelis-Menten, Hill, etc.)
Perform ANOVA to identify significant differences between temperature response profiles
Use principal component analysis to identify patterns in multidimensional kinetic data
Data interpretation guidelines:
Distinguish between thermodynamic (equilibrium) stability and kinetic (rate) stability
Evaluate cooperativity effects at different temperatures
Consider the contribution of protein-solvent interactions to thermal stability differences
This comprehensive analytical approach helps researchers correctly interpret the molecular basis for thermal adaptation in nuoA proteins and avoids common misinterpretations of thermostability data .
When analyzing nuoA protein purification efficiency, researchers should implement the following controls and statistical considerations:
| Control Type | Implementation | Purpose |
|---|---|---|
| Expression baseline | Analyze total expression in cell lysate pre-purification | Establishes maximum theoretical yield |
| Negative controls | Process non-transformed cells through identical protocol | Identifies non-specific binding artifacts |
| Positive controls | Include a well-characterized His-tagged protein | Validates purification system functionality |
| Column saturation tests | Analyze flow-through for target protein presence | Determines optimal resin:protein ratio |
| Degradation controls | Monitor purified protein stability over time | Identifies potential proteolysis issues |
Statistical considerations:
Replicate analysis: Perform at least triplicate purifications to establish variance
Yield quantification: Calculate recovery percentages at each purification step
Purity assessment: Use densitometry on SDS-PAGE rather than visual estimation
Statistical tests: Apply appropriate tests (t-tests, ANOVA) to compare purification conditions
Outlier detection: Implement Grubbs or Dixon's Q-test to identify anomalous results
Through rigorous statistical analysis, researchers can objectively evaluate purification efficiency and identify protocol optimization opportunities .
When confronted with contradictory activity data between different nuoA protein preparations, researchers should implement the following systematic troubleshooting approach:
Source verification:
Confirm identical gene sequences between preparations
Verify expression vector integrity through sequencing
Examine strain differences in expression hosts
Preparation analysis:
Compare purification methods, focusing on detergent types and concentrations
Analyze protein conformational state through circular dichroism
Assess oligomerization state through size exclusion chromatography
Examine post-translational modifications through mass spectrometry
Activity assay standardization:
Normalize protein concentrations using multiple quantification methods
Standardize buffer compositions, particularly pH and ionic strength
Control temperature parameters precisely (±0.1°C)
Validate substrate quality and concentration
Systematic elimination of variables:
Exchange buffers between preparations to identify buffer-dependent effects
Test activity under multiple conditions simultaneously
Implement crossed experimental designs to identify interaction effects
Statistical reanalysis:
Pool raw data from different experiments for meta-analysis
Apply Bayesian methods to incorporate prior knowledge
Use bootstrapping to establish confidence intervals
This methodical approach helps identify the source of contradictions and establishes consensus activity values .
Researchers can utilize nuoA as a model system for studying electron transport chains in thermophilic bacteria through the following approaches:
Reconstitution studies:
Reconstitute purified nuoA with other NADH dehydrogenase complex components
Create artificial membrane systems (liposomes) mimicking the native environment
Measure electron transfer rates at different temperatures (45-70°C)
Comparative genomic approaches:
Analyze nuoA sequence conservation across thermophilic species
Identify co-evolved residues essential for thermostable electron transport
Map evolutionary adaptations specific to thermophilic electron transport chains
Structural biology integration:
Implement cryo-EM studies of the complete NADH dehydrogenase complex
Analyze interaction surfaces between nuoA and other complex components
Identify structural elements responsible for thermal stability of the assembled complex
Functional assays:
Develop high-throughput assays for electron transport efficiency
Measure proton pumping efficiency coupled to electron transport
Quantify reactive oxygen species generation at different temperatures
This comprehensive approach allows researchers to gain insights into the adaptation of respiratory chains to thermophilic environments and provides a model for understanding electron transport mechanisms under extreme conditions .
When studying the evolution of thermostability in nuoA across different Geobacillus species, researchers should consider the following methodological approaches:
Phylogenetic analysis framework:
Construct robust phylogenetic trees using multiple genetic markers
Map optimal growth temperatures onto phylogenies
Identify ancestral sequences through maximum likelihood reconstruction
Sequence-based comparative analysis:
Calculate amino acid composition biases across temperature gradients
Identify conserved residues in thermophilic versus mesophilic species
Apply statistical coupling analysis to detect co-evolving networks of residues
Structural comparison methodologies:
Perform homology modeling of nuoA from species with different optimal temperatures
Calculate electrostatic surface potentials across homologs
Quantify differences in predicted hydrogen bonding and salt bridge networks
Experimental validation strategies:
Express recombinant nuoA from multiple species under identical conditions
Measure thermal denaturation curves using differential scanning calorimetry
Create chimeric proteins to isolate specific thermostabilizing elements
Data integration approaches:
Correlate thermostability with genomic GC content
Analyze codon usage bias in relation to thermal adaptation
Implement machine learning to identify patterns in multidimensional data
This comprehensive evolutionary approach reveals the molecular mechanisms underlying thermal adaptation in respiratory chain components .