Recombinant Geobacillus thermodenitrificans NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Introduction

NADH-quinone oxidoreductase subunit A (nuoA) is a component of the NADH:quinone oxidoreductase I (NDH-1) complex, an enzyme that catalyzes the transfer of electrons from NADH to quinones in the respiratory chain . NDH-1 contributes to the generation of a proton electrochemical gradient across the cytoplasmic membrane . In Geobacillus thermodenitrificans, nuoA is essential for the function of the NDH-1 complex.

General Function and Biological Properties

NADH-quinone oxidoreductase subunit A (nuoA) is involved in oxidoreductase activity, acting on NADH or NADPH . NDH-1 transports electrons from NADH, using flavin mononucleotide (FMN) and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain . Ubiquinone is thought to be the direct electron acceptor for the enzyme in this species . The redox reaction is coupled to proton translocation, where four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, which conserves the redox energy in a proton gradient .

Gene Information

The gene name for NADH-quinone oxidoreductase subunit A is nuoA . Synonyms for nuoA include GTNG_3302, NADH dehydrogenase I subunit A, NADH-quinone oxidoreductase subunit A, NDH-1 subunit A, and NUO1 . In Escherichia coli, the gene nuoF encodes for the polypeptide NADH:quinone oxidoreductase subunit F .

Protein Characteristics

Recombinant Full Length Geobacillus thermodenitrificans NADH-quinone oxidoreductase subunit A(nuoA) Protein, His-Tagged is a protein expressed in E. coli . It is fused to an N-terminal His tag and has a full length of 1-122 amino acids . The amino acid sequence is: MSNIYANSYLIVFVFLCLGVLLPIGALTIGRWLRPNVPDEAKATTYESGNIPFHDSRIQF QVRYYLFALLFVIFDVETVFLYPWAVVYDQLGLFALVEMIIFIVLLAIGLIYAWKKKVLR WM . The protein's purity is greater than 90% as determined by SDS-PAGE .

MmNQO from Methanothermobacter marburgensis

Methanothermobacter marburgensis possesses a gene (Gene ID 9704440) that encodes for a putative NAD(P)H:quinone oxidoreductase, referred to as MmNQO . MmNQO is a flavin-dependent NADH:quinone oxidoreductase capable of oxidizing NADH in the presence of various electron acceptors, while NADPH oxidation occurs with a smaller subset of acceptors . The enzyme is a homodimer, with each monomer consisting of 196 residues folded into flavodoxin-like α/β domains with non-covalently bound FMN .

MmNQO Biochemical Properties

Recombinant His6-tagged MmNQO was purified to homogeneity, with an apparent molecular weight of approximately 24,000 Da as determined by SDS-PAGE, consistent with the theoretical molecular weight of 23,538 Da . The purified MmNQO was tested for NADH:quinone oxidoreductase activity using NADH or NADPH as electron donors and various electron acceptors . With NADH, MmNQO exhibited activity with all electron acceptors tested, whereas NADPH was oxidized with fewer electron acceptors, typically showing 2- to 20-fold lower activity compared to NADH . The highest specific activity was observed with NADH and Ferrocenium hexafluorophosphate as the electron acceptor .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
nuoA; GTNG_3302; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Geobacillus thermodenitrificans (strain NG80-2)
Target Names
nuoA
Target Protein Sequence
MSNIYANSYLIVFVFLCLGVLLPIGALTIGRWLRPNVPDEAKATTYESGNIPFHDSRIQF QVRYYLFALLFVIFDVETVFLYPWAVVYDQLGLFALVEMIIFIVLLAIGLIYAWKKKVLR WM
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, the primary electron acceptor is believed to be a menaquinone. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thus generating a proton gradient that stores redox energy.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the general characteristics of Geobacillus thermodenitrificans as a source organism?

Geobacillus thermodenitrificans is a rod-shaped, Gram-positive thermophilic bacterium capable of growth between 45-70°C under neutral pH conditions . As a thermophile, its proteins have evolved structural adaptations for thermal stability, making them valuable for industrial and research applications requiring robust enzymatic activity at elevated temperatures. Geobacillus thermodenitrificans IBRL-nra strain has been extensively studied, particularly for its thermostable enzymes that maintain functionality under extreme conditions .

How does Geobacillus thermodenitrificans nuoA compare structurally with mesophilic homologs?

The nuoA protein from Geobacillus thermodenitrificans shows structural characteristics typical of thermophilic proteins compared to mesophilic counterparts. The thermostable nature of proteins from this organism generally results from increased hydrophobic interactions, additional salt bridges, and more compact folding that together enhance stability at elevated temperatures. The nuoA protein specifically contains 122 amino acids, predominantly hydrophobic residues, which is consistent with its membrane-associated function in the NADH dehydrogenase complex . While mesophilic homologs maintain similar core functional domains, they typically contain fewer stabilizing features and may denature at temperatures where the Geobacillus protein remains fully functional.

What expression system is optimal for producing recombinant Geobacillus thermodenitrificans nuoA protein?

The optimal expression system for recombinant Geobacillus thermodenitrificans nuoA protein is Escherichia coli with a His-tag fusion . This system offers several methodological advantages:

  • Vector design: Use of vectors containing T7 promoter systems compatible with His-tag fusion proteins

  • Expression conditions: Induction at lower temperatures (25-30°C) despite the thermophilic origin of the protein

  • Fusion structure: N-terminal His-tag placement to facilitate purification while minimizing interference with protein folding

The E. coli expression system provides sufficient yields while maintaining proper folding of the thermostable protein. For researchers working with membrane proteins like nuoA, specialized E. coli strains such as C41(DE3) or C43(DE3) may offer improved expression of potentially toxic membrane proteins .

What is the recommended purification protocol for recombinant Geobacillus thermodenitrificans nuoA?

The recommended purification protocol leverages the His-tag fusion design and includes the following methodological steps:

  • Cell lysis: Sonication in a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and 10 mM imidazole

  • Initial clarification: Centrifugation at 10,000 g for 30 minutes to remove cell debris

  • Membrane protein solubilization: Treatment with 1% detergent (typically n-dodecyl-β-D-maltoside)

  • Affinity chromatography: Nickel-NTA column with washing using 20 mM imidazole and elution with 250 mM imidazole

  • Buffer exchange: Dialysis against a storage buffer containing 20 mM Tris-HCl (pH 8.0), 150 mM NaCl, and 6% trehalose

  • Quality control: SDS-PAGE verification achieving >90% purity

After purification, the protein should be stored as specified in section 2.3 to maintain stability and activity.

What are the optimal storage conditions for preserving nuoA protein activity?

The optimal storage conditions for preserving nuoA protein activity are:

Storage ParameterRecommended ConditionNotes
FormLyophilized powderMaximizes long-term stability
Short-term storage4°CFor working aliquots (up to one week)
Long-term storage-20°C to -80°CAliquoting necessary to avoid freeze-thaw cycles
Buffer compositionTris/PBS-based buffer with 6% trehalose, pH 8.0Trehalose acts as a cryoprotectant
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLAdd 5-50% glycerol (final concentration)
Freeze-thaw cyclesAvoid repeated cyclesSignificantly reduces protein activity

Researchers should centrifuge the vial briefly before opening to bring contents to the bottom and prepare small working aliquots to minimize freeze-thaw cycles .

How can researchers optimize experimental design when studying nuoA protein activity at varying temperatures?

Researchers studying nuoA protein activity across temperature ranges should implement the following experimental design optimizations:

  • Model parameter resolution: Define temperature-dependent variables that could affect protein activity and stability through preliminary testing

  • Non-linear response modeling: As enzyme kinetics often follow non-linear relationships, apply global optimization theory to examine how temperature affects activity patterns

  • Robustness implementation: Design experiments that are relatively immune to potential bias errors by:

    • Including redundant measurement points at critical temperatures

    • Designing calibration curves specific to each temperature range

    • Implementing statistical validation of unexpected results

  • Reference points: Include both Geobacillus thermodenitrificans lipase activity points (which function optimally at 65°C) and mesophilic homologs to provide comparative benchmarks

This approach treats experimental design as an iterative exercise in hypothesis testing, allowing researchers to delineate critical data ranges that are most important for resolving the temperature-dependent activity model .

What considerations are important when designing substrate specificity experiments for nuoA?

When designing substrate specificity experiments for nuoA, researchers should consider the following methodological approaches:

  • Substrate panel design: Create a diverse substrate panel including:

    • Natural NADH substrates with varying chain lengths and modifications

    • Synthetic analogs with systematic structural variations

    • Competitive inhibitors to probe binding site characteristics

  • Experimental controls:

    • Positive controls using known high-affinity substrates

    • Negative controls with structurally dissimilar molecules

    • Parallel testing with well-characterized homologous proteins

  • Detection methodologies:

    • Spectrophotometric assays monitoring NADH oxidation at 340 nm

    • Oxygen consumption measurements for complete electron transfer chains

    • Coupled enzyme assays for indirect activity detection

  • Statistical design principles:

    • Randomization of testing order to eliminate systematic bias

    • Replication to assess experimental variance

    • Factorial design to detect interaction effects between variables

This comprehensive approach ensures robust characterization of substrate specificity while minimizing experimental artifacts.

How can researchers integrate molecular dynamics simulations with experimental data when studying nuoA protein conformational changes?

Researchers can integrate molecular dynamics (MD) simulations with experimental data for nuoA through the following methodological framework:

  • Structure preparation:

    • Use the known amino acid sequence (MSNIYANSYLIVFVFLCLGVLLPIGALTIGR...) to generate homology models if crystal structures are unavailable

    • Validate structural models through secondary structure predictions and Ramachandran plot analysis

  • Simulation parameterization informed by experiments:

    • Set temperature parameters to match experimental conditions (45-70°C range)

    • Include appropriate membrane models to simulate the native environment

    • Incorporate experimental binding affinity data to validate force field parameters

  • Iterative refinement process:

    • Run initial simulations and compare predicted conformational changes with experimental observables

    • Refine models based on discrepancies between simulation and experiment

    • Implement bias-exchange metadynamics to enhance sampling of rare conformational states

  • Experimental validation of simulation predictions:

    • Design site-directed mutagenesis experiments targeting residues identified in simulations

    • Conduct spectroscopic experiments (circular dichroism, fluorescence) to validate predicted structural changes

    • Perform functional assays to correlate structural predictions with activity measurements

This integrated approach allows researchers to overcome limitations of both computational and experimental techniques in isolation .

How should researchers analyze kinetic data for thermostable nuoA compared to mesophilic homologs?

Researchers analyzing kinetic data for thermostable nuoA versus mesophilic homologs should employ the following analytical framework:

  • Temperature-normalized comparisons:

    • Plot relative activity (percentage of maximum) versus temperature for both protein types

    • Calculate temperature optima (Topt) and temperature range breadth (T90, range where activity exceeds 90% of maximum)

    • Apply Arrhenius plots to extract activation energies (Ea) and identify temperature breakpoints

  • Thermodynamic parameter extraction:

    • Calculate ΔH‡, ΔS‡, and ΔG‡ values using transition state theory equations

    • Compare entropy-enthalpy compensation between thermophilic nuoA and mesophilic homologs

    • Construct temperature-dependent free energy diagrams to visualize stability differences

  • Statistical analysis methods:

    • Apply non-linear regression to fit enzyme kinetic models (Michaelis-Menten, Hill, etc.)

    • Perform ANOVA to identify significant differences between temperature response profiles

    • Use principal component analysis to identify patterns in multidimensional kinetic data

  • Data interpretation guidelines:

    • Distinguish between thermodynamic (equilibrium) stability and kinetic (rate) stability

    • Evaluate cooperativity effects at different temperatures

    • Consider the contribution of protein-solvent interactions to thermal stability differences

This comprehensive analytical approach helps researchers correctly interpret the molecular basis for thermal adaptation in nuoA proteins and avoids common misinterpretations of thermostability data .

What controls and statistical considerations are essential when analyzing nuoA protein purification efficiency?

When analyzing nuoA protein purification efficiency, researchers should implement the following controls and statistical considerations:

Control TypeImplementationPurpose
Expression baselineAnalyze total expression in cell lysate pre-purificationEstablishes maximum theoretical yield
Negative controlsProcess non-transformed cells through identical protocolIdentifies non-specific binding artifacts
Positive controlsInclude a well-characterized His-tagged proteinValidates purification system functionality
Column saturation testsAnalyze flow-through for target protein presenceDetermines optimal resin:protein ratio
Degradation controlsMonitor purified protein stability over timeIdentifies potential proteolysis issues

Statistical considerations:

  • Replicate analysis: Perform at least triplicate purifications to establish variance

  • Yield quantification: Calculate recovery percentages at each purification step

  • Purity assessment: Use densitometry on SDS-PAGE rather than visual estimation

  • Statistical tests: Apply appropriate tests (t-tests, ANOVA) to compare purification conditions

  • Outlier detection: Implement Grubbs or Dixon's Q-test to identify anomalous results

Through rigorous statistical analysis, researchers can objectively evaluate purification efficiency and identify protocol optimization opportunities .

How can researchers resolve contradictory activity data between different nuoA protein preparations?

When confronted with contradictory activity data between different nuoA protein preparations, researchers should implement the following systematic troubleshooting approach:

  • Source verification:

    • Confirm identical gene sequences between preparations

    • Verify expression vector integrity through sequencing

    • Examine strain differences in expression hosts

  • Preparation analysis:

    • Compare purification methods, focusing on detergent types and concentrations

    • Analyze protein conformational state through circular dichroism

    • Assess oligomerization state through size exclusion chromatography

    • Examine post-translational modifications through mass spectrometry

  • Activity assay standardization:

    • Normalize protein concentrations using multiple quantification methods

    • Standardize buffer compositions, particularly pH and ionic strength

    • Control temperature parameters precisely (±0.1°C)

    • Validate substrate quality and concentration

  • Systematic elimination of variables:

    • Exchange buffers between preparations to identify buffer-dependent effects

    • Test activity under multiple conditions simultaneously

    • Implement crossed experimental designs to identify interaction effects

  • Statistical reanalysis:

    • Pool raw data from different experiments for meta-analysis

    • Apply Bayesian methods to incorporate prior knowledge

    • Use bootstrapping to establish confidence intervals

This methodical approach helps identify the source of contradictions and establishes consensus activity values .

How can researchers utilize nuoA as a model for studying electron transport chains in thermophilic bacteria?

Researchers can utilize nuoA as a model system for studying electron transport chains in thermophilic bacteria through the following approaches:

  • Reconstitution studies:

    • Reconstitute purified nuoA with other NADH dehydrogenase complex components

    • Create artificial membrane systems (liposomes) mimicking the native environment

    • Measure electron transfer rates at different temperatures (45-70°C)

  • Comparative genomic approaches:

    • Analyze nuoA sequence conservation across thermophilic species

    • Identify co-evolved residues essential for thermostable electron transport

    • Map evolutionary adaptations specific to thermophilic electron transport chains

  • Structural biology integration:

    • Implement cryo-EM studies of the complete NADH dehydrogenase complex

    • Analyze interaction surfaces between nuoA and other complex components

    • Identify structural elements responsible for thermal stability of the assembled complex

  • Functional assays:

    • Develop high-throughput assays for electron transport efficiency

    • Measure proton pumping efficiency coupled to electron transport

    • Quantify reactive oxygen species generation at different temperatures

This comprehensive approach allows researchers to gain insights into the adaptation of respiratory chains to thermophilic environments and provides a model for understanding electron transport mechanisms under extreme conditions .

What are the methodological considerations for studying the evolution of thermostability in nuoA across different Geobacillus species?

When studying the evolution of thermostability in nuoA across different Geobacillus species, researchers should consider the following methodological approaches:

  • Phylogenetic analysis framework:

    • Construct robust phylogenetic trees using multiple genetic markers

    • Map optimal growth temperatures onto phylogenies

    • Identify ancestral sequences through maximum likelihood reconstruction

  • Sequence-based comparative analysis:

    • Calculate amino acid composition biases across temperature gradients

    • Identify conserved residues in thermophilic versus mesophilic species

    • Apply statistical coupling analysis to detect co-evolving networks of residues

  • Structural comparison methodologies:

    • Perform homology modeling of nuoA from species with different optimal temperatures

    • Calculate electrostatic surface potentials across homologs

    • Quantify differences in predicted hydrogen bonding and salt bridge networks

  • Experimental validation strategies:

    • Express recombinant nuoA from multiple species under identical conditions

    • Measure thermal denaturation curves using differential scanning calorimetry

    • Create chimeric proteins to isolate specific thermostabilizing elements

  • Data integration approaches:

    • Correlate thermostability with genomic GC content

    • Analyze codon usage bias in relation to thermal adaptation

    • Implement machine learning to identify patterns in multidimensional data

This comprehensive evolutionary approach reveals the molecular mechanisms underlying thermal adaptation in respiratory chain components .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.