Recombinant Geobacillus thermodenitrificans NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Production Methodology

Expressed in Escherichia coli BL21(DE3) systems, the protein undergoes optimized fermentation at 37°C with IPTG induction. Critical production parameters:

ParameterValue
Expression VectorpET-28a(+)
Solubilization Agent1% n-dodecyl-β-D-maltoside (DDM)
Final Purity>90% (SDS-PAGE verified)
Yield5-8 mg/L culture

Lyophilized formulations contain 6% trehalose in Tris/PBS buffer (pH 8.0) for enhanced stability . Functional reconstitution requires 0.1-1.0 mg/mL concentrations in lipid bilayers with 50% glycerol cryoprotectant .

Functional Role in Respiratory Complex I

As part of the NADH:quinone oxidoreductase (EC 1.6.99.5), nuoK contributes to:

  • Electron Transfer: Mediates ubiquinone reduction through conserved tyrosine residues

  • Proton Translocation: Participates in coupling redox reactions to Na+/H+ pumping

  • Structural Stabilization: Maintains interface between membrane and matrix domains

Comparative studies with Vibrio cholerae homolog show 72% sequence similarity, retaining sodium-pumping capability but with enhanced thermostability (functional up to 70°C) .

Research Applications

Recent studies highlight its utility in:

  • Enzyme Engineering: Template for chimeric complex I assemblies

  • Metabolic Studies: Probe for thermophilic electron transport mechanisms

  • Biotechnological Systems: Integration into bioelectrochemical devices for enhanced NAD+ regeneration

Stability Profile

The recombinant protein demonstrates exceptional thermal tolerance:

ConditionStability
TemperatureStable at 60°C for 1 hour
pH Range6.5-8.5 (optimal activity at pH 7.8)
Lyophilized Storage12 months at -80°C

Repeated freeze-thaw cycles >3x cause 30% activity loss, necessitating single-use aliquots .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
nuoK; GTNG_3295; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Geobacillus thermodenitrificans (strain NG80-2)
Target Names
nuoK
Target Protein Sequence
MTLSAYLALALILFCIGLYGALTKRNTVIVLICIELMLNAVNINFVAFAKYGAHPGVHGH VFALFAIAIAAAEAAVGLAALIAFYRNRKTVQVDEANSLKH
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, the primary electron acceptor is believed to be a menaquinone. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal growth conditions for Geobacillus thermodenitrificans?

Geobacillus thermodenitrificans is a rod-shaped, Gram-positive thermophile that thrives within a temperature range of 45-70°C, with optimal growth occurring at 65°C under neutral pH conditions. For laboratory cultivation, a recommended growth medium contains 1.0% (w/v) glucose, 1.25% (w/v) yeast extract, 0.45% (w/v) NaCl, and may be supplemented with 0.10% olive oil. Incubation should be conducted at pH 6.8 with agitation at 200 rpm. Under these conditions, proper growth can typically be achieved within 24 hours .

How does the G+C content of Geobacillus thermodenitrificans compare to other Geobacillus species?

The G+C content of Geobacillus thermodenitrificans distinguishes it from other members of the genus. Unlike species in the "kaustophilus clade" such as G. thermoleovorans (52%), G. vulcani (53%), G. lituanicus (52.5%), G. kaustophilus (51.9%), and G. thermocatenulatus (55%), G. thermodenitrificans falls into the denitrifying clade with a G+C content of approximately 48.9%. This positions it between the high G+C "kaustophilus clade" and the lower G+C facultative anaerobes like G. caldoxylosylitus (44%), G. toebii (43.9%), and G. thermoglucosidasius (43.9%) . These genomic characteristics should be considered when designing primers and planning gene expression experiments.

What are the key considerations for designing primers for nuoK amplification from Geobacillus thermodenitrificans?

When designing primers for nuoK amplification from G. thermodenitrificans, researchers should consider:

  • Thermostability: Use primers with high GC content and melting temperatures above 60°C to ensure stability during high-temperature PCR steps required for this thermophilic organism.

  • Specificity: Analyze the full genome sequence to ensure primers bind exclusively to the nuoK gene.

  • Codon optimization: If expressing in a heterologous host like E. coli, consider the difference in codon usage between the thermophilic source and mesophilic expression host.

  • Restriction sites: Include appropriate restriction sites for subsequent cloning, ensuring these sites do not exist within the nuoK gene sequence.

  • Expression tags: Consider incorporating sequences for affinity tags (His-tag, similar to the approach used with NosZ) to facilitate protein purification.

For optimal PCR conditions with G. thermodenitrificans genomic DNA, use a high-fidelity polymerase with a touchdown PCR protocol starting at 68°C and gradually decreasing to 62°C to ensure specific amplification.

What strategies can optimize heterologous expression of G. thermodenitrificans nuoK in E. coli?

Heterologous expression of G. thermodenitrificans nuoK in E. coli presents several challenges due to its nature as a membrane protein from a thermophilic organism. The following methodological approach is recommended:

StrategyImplementationRationale
Vector selectionpET series with T7 promoterProvides strong, inducible expression
Host strainC41(DE3) or C43(DE3)Specialized strains for membrane protein expression
Induction conditions0.1-0.5 mM IPTG, 25-30°CLower temperatures reduce inclusion body formation
Membrane extractionUltracentrifugation (100,000 g) with detergentsEffectively separates membrane fractions
Protein solubilizationDDM or LDAO detergentsPreserves structural integrity of membrane proteins
Metal supplementationAddition of copper compoundsEnhances activity, similar to NosZ

Drawing from the experience with NosZ expression, preincubation under anaerobic conditions (argon) with copper compounds may enhance the proper folding and activity of nuoK . When purifying the recombinant protein, use a His-tagged fusion approach with immobilized metal affinity chromatography, followed by size exclusion chromatography to obtain pure, active protein.

How can researchers determine the optimal sample size for enzymatic activity assays of recombinant nuoK?

Determining the appropriate sample size for nuoK enzymatic activity assays requires careful statistical consideration. A proper power analysis should account for:

  • Expected effect size (typically the minimum biologically relevant difference in activity)

  • Desired statistical power (conventionally set at 0.8 or 0.9)

  • Significance level (typically α = 0.05)

  • Variance of the measurement (determined from pilot experiments)

For a two-sample t-test comparing wild-type and mutant nuoK activity, the sample size (n) per group can be calculated using:

n=2(Zα/2+Zβ)2σ2Δ2n = \frac{2(Z_{\alpha/2} + Z_{\beta})^2\sigma^2}{\Delta^2}

Where:

  • Z<sub>α/2</sub> is the critical value of the normal distribution at α/2 (1.96 for α = 0.05)

  • Z<sub>β</sub> is the critical value of the normal distribution at β (0.84 for 80% power)

  • σ is the standard deviation of the outcome variable

  • Δ is the minimum detectable difference

Remember that sample size increases with power, decreases with larger detectable differences, increases proportionally to variance, and two-sided tests require larger sample sizes than one-sided tests . For typical enzyme kinetics experiments, start with a minimum of 3-5 biological replicates with 3 technical replicates each to achieve sufficient statistical power.

What are the recommended methods for measuring NADH-quinone oxidoreductase activity of recombinant nuoK?

To accurately measure NADH-quinone oxidoreductase activity of recombinant nuoK, employ the following methodological approach:

  • Spectrophotometric NADH oxidation assay:

    • Monitor decreasing absorbance at 340 nm as NADH (ε = 6.22 mM⁻¹cm⁻¹) is oxidized

    • Reaction buffer: 50 mM phosphate buffer (pH 7.5), 100 mM NaCl, thermostated at 65°C

    • Substrates: 100 μM NADH and 50 μM ubiquinone-1 (CoQ₁)

    • Calculate activity as μmol NADH oxidized per minute per mg protein

  • Oxygen consumption assay:

    • Use a Clark-type oxygen electrode in a sealed chamber

    • Measure oxygen reduction rate at 65°C

    • Calculate the stoichiometric relationship between NADH oxidation and oxygen reduction

  • Artificial electron acceptor assay:

    • Employ ferricyanide as an artificial electron acceptor

    • Monitor reduction at 420 nm (ε = 1.0 mM⁻¹cm⁻¹)

    • Useful for distinguishing intact complex activity versus individual subunit function

Given the thermophilic nature of G. thermodenitrificans, assays should be conducted at the optimal temperature of 65°C to accurately determine physiologically relevant activity. Control assays using specific inhibitors (e.g., rotenone) can help distinguish Complex I activity from other NADH-oxidizing enzymes.

What methods can be used to study the membrane topology of nuoK in G. thermodenitrificans?

To elucidate the membrane topology of nuoK from G. thermodenitrificans, a combination of computational prediction and experimental verification is recommended:

MethodTechniqueData Generated
ComputationalTMHMM, HMMTOPPrediction of transmembrane helices
Substituted cysteine accessibility method (SCAM)Site-directed mutagenesis + thiol-reactive reagentsExperimental validation of exposed residues
PhoA/LacZ fusionFusion protein expressionDetermination of cytoplasmic/periplasmic domains
Cryo-electron microscopyDirect structural analysisHigh-resolution structural information
Protease protection assayLimited proteolysisIdentification of accessible protein regions

For the experimental approach, systematically introduce single cysteine residues throughout the protein via site-directed mutagenesis. Express these mutants and treat intact membrane vesicles with membrane-impermeable thiol-reactive reagents. Residues accessible to modification are located on the exterior face of the membrane. This technique should be performed at 65°C to maintain the native conformation of this thermophilic protein.

How should researchers analyze kinetic data from recombinant G. thermodenitrificans nuoK enzyme assays?

Proper analysis of kinetic data from recombinant G. thermodenitrificans nuoK enzyme assays requires:

  • Determination of kinetic parameters:

    • Plot initial velocity (v₀) versus substrate concentration [S] data

    • Fit to the Michaelis-Menten equation: v₀ = (Vmax × [S])/(Km + [S])

    • Use non-linear regression rather than linear transformations (e.g., Lineweaver-Burk) for more accurate parameter estimation

    • Report Km, Vmax, kcat, and catalytic efficiency (kcat/Km)

  • Temperature dependence analysis:

    • Measure activity at temperatures from 45°C to 80°C

    • Generate an Arrhenius plot (ln(k) vs. 1/T) to determine activation energy

    • Calculate Q10 values to quantify the temperature dependence

  • pH profile analysis:

    • Measure activity across pH range 5.0-9.0

    • Plot activity versus pH to determine optimal pH and pKa values of catalytically important residues

  • Inhibition studies:

    • Determine inhibition type (competitive, noncompetitive, uncompetitive, mixed)

    • Calculate inhibition constants (Ki)

    • Use inhibition patterns to infer binding sites and mechanisms

For thermophilic enzymes like nuoK from G. thermodenitrificans, ensure all analyses account for the elevated temperature optima. Standard kinetic models may need modification to incorporate temperature effects on enzyme stability and activity.

What statistical approaches are recommended for comparing wild-type and mutant forms of recombinant nuoK?

When comparing wild-type and mutant forms of recombinant nuoK, apply these statistical approaches:

  • For parametric data with normal distribution:

    • Two-sample t-test for single comparison between wild-type and one mutant

    • One-way ANOVA followed by post-hoc tests (Tukey's HSD) for multiple mutant comparisons

    • Paired t-tests for before/after treatments on the same protein preparations

  • For non-parametric or non-normally distributed data:

    • Mann-Whitney U test for two-sample comparisons

    • Kruskal-Wallis test followed by Dunn's test for multiple comparisons

  • For kinetic parameter comparisons:

    • Extra sum-of-squares F test to determine if kinetic parameters differ significantly

    • Bootstrap analysis to generate confidence intervals for kinetic parameters

    • Akaike Information Criterion (AIC) to compare different kinetic models

  • For thermal stability comparisons:

    • Comparison of T50 values (temperature at which 50% activity remains)

    • Statistical analysis of thermal denaturation curves using appropriate models

Ensure proper sample size determination through power analysis as described earlier . Report effect sizes and confidence intervals along with p-values to provide a complete statistical picture. For complex comparisons across multiple conditions, consider multifactorial experimental designs to efficiently detect interaction effects between mutations and environmental conditions.

What are the common challenges in purifying active recombinant nuoK and how can they be addressed?

Purification of active recombinant nuoK presents several challenges. Here are common issues and their solutions:

ChallengeSymptomsSolution
Low expression yieldMinimal protein detectionOptimize codon usage; reduce expression temperature; use specialized expression strains
Protein aggregationInclusion body formationExpress at lower temperatures (20-25°C); add solubility tags; use detergents optimized for membrane proteins
Loss of cofactorsReduced specific activitySupplement growth media with copper compounds; maintain anaerobic conditions during purification
Denaturation during purificationActivity loss after purification stepsInclude stabilizing agents (glycerol, specific ions); maintain thermophile-appropriate conditions
Proteolytic degradationMultiple bands on SDS-PAGEAdd protease inhibitors; reduce purification time; perform work at 4°C

Like the NosZ protein from G. thermodenitrificans, proper metal incorporation is crucial for activity. Consider preincubation under argon with copper compounds to enhance activity . For membrane proteins like nuoK, detergent selection is critical—start with a panel of detergents (DDM, LDAO, CHAPS) to determine which best maintains structural integrity and activity.

Additionally, expression under oxygen-limited conditions may improve yield and activity, as many subunits of respiratory complexes are sensitive to oxidative damage during heterologous expression.

How can researchers address inconsistent kinetic data when characterizing nuoK activity?

When faced with inconsistent kinetic data during nuoK characterization, implement the following methodological approaches:

  • Standardize enzyme preparation:

    • Use consistent cell disruption methods (sonication time, pressure for French press)

    • Implement rigorous protein quantification protocols (BCA assay with BSA standards)

    • Prepare single large batches of enzyme for comparative experiments

  • Control assay conditions:

    • Maintain precise temperature control (±0.1°C) during assays

    • Use temperature-equilibrated buffers and solutions

    • Standardize the order of reagent addition and timing

  • Address data quality issues:

    • Implement statistical outlier detection methods (Grubbs' test, Dixon's Q test)

    • Perform regression diagnostics (residual analysis, influence plots)

    • Use weighted regression for heteroscedastic data

  • Design sequential experiments:

    • Begin with broad parameter ranges, then narrow focus

    • Use optimal experimental design approaches (D-optimal design for kinetic parameters)

    • Implement response surface methodology to map optimal conditions

  • Technical considerations for thermophilic enzymes:

    • Account for spontaneous substrate degradation at high temperatures

    • Consider thermal gradients in spectrophotometric assays

    • Use sealed reaction vessels to prevent evaporation

For complex multi-subunit enzymes like NADH-quinone oxidoreductase, ensure all components are present in stoichiometric amounts. If expressing individual subunits like nuoK, consider reconstitution with other subunits to achieve physiologically relevant activity measurements.

What are the emerging research questions regarding G. thermodenitrificans nuoK that remain to be addressed?

Several critical questions remain unexplored regarding G. thermodenitrificans nuoK that merit further investigation:

Future studies should employ advanced techniques such as cryo-electron microscopy to resolve the structure of the entire respiratory complex, in-vivo proton translocation measurements to connect structure with function, and systems biology approaches to understand the integration of nuoK function within the broader metabolic network of G. thermodenitrificans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.