Recombinant Geobacillus thermodenitrificans Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Geobacillus thermodenitrificans Prolipoprotein Diacylglyceryl Transferase (Lgt)

Recombinant Geobacillus thermodenitrificans Prolipoprotein Diacylglyceryl Transferase (Lgt) is a genetically engineered protein derived from the thermophilic bacterium Geobacillus thermodenitrificans (strain NG80-2). It is a critical enzyme involved in bacterial lipoprotein biosynthesis, catalyzing the attachment of a diacylglyceryl moiety from phosphatidylglycerol to the conserved +1 cysteine residue of prolipoproteins . This recombinant protein is commercially available for research purposes, including enzymatic assays, antibody development, and structural studies .

Catalytic Mechanism and Substrate Specificity

Lgt enzymes universally function as diacylglyceryl transferases, transferring lipid moieties from phosphatidylglycerol to prolipoproteins. While detailed biochemical data for G. thermodenitrificans Lgt are unavailable, studies on homologs (e.g., E. coli Lgt) reveal:

  • Seven transmembrane segments, with the N-terminus facing the periplasm and the C-terminus the cytoplasm .

  • Essential residues include Y26, N146, and G154, which are critical for enzyme activity .

Role in Lipoprotein Biosynthesis

Lgt is indispensable for lipoprotein maturation, a process critical for bacterial membrane integrity and virulence in pathogens like Bacillus anthracis . In G. thermodenitrificans, Lgt likely facilitates the biogenesis of lipoproteins involved in thermotolerance and stress adaptation.

Use in Antibiotic Discovery

Though not directly tested in G. thermodenitrificans, Lgt inhibition in E. coli and Acinetobacter baumannii has shown bactericidal effects, validating it as a druggable target . The recombinant G. thermodenitrificans Lgt may serve as a model for developing inhibitors targeting thermophilic pathogens.

Applications in Research Tools

The recombinant protein is used in:

  1. ELISA assays to detect Lgt-specific antibodies or inhibitors .

  2. Enzymatic activity screens to study substrate specificity or inhibitor binding .

Table 1: Key Properties of Recombinant G. thermodenitrificans Lgt

PropertySpecification
Source OrganismGeobacillus thermodenitrificans (strain NG80-2)
Expression Region1–270 (full-length)
Storage Conditions-20°C or -80°C; avoid repeated freeze-thaw cycles
ActivityDiacylglyceryl transferase (phosphatidylglycerol → prolipoprotein)

Table 2: Amino Acid Sequence Highlights (Partial)

SegmentSequence
N-Terminal RegionMMEPAIEPLDRVFLQLGPITIYWYGVIIGTGVLIGLWLATRESVRRGLPKETFVDLVLFA
C-Terminal RegionQVMSITLIIIALVLWMVRRAKGWARERYMD

Future Directions and Challenges

  1. Structural Elucidation: High-resolution crystallography or cryo-EM studies to define substrate-binding pockets and conformational dynamics.

  2. Therapeutic Potential: Screening for inhibitors that target G. thermodenitrificans Lgt, leveraging insights from E. coli Lgt inhibitors .

  3. Functional Studies: Investigating Lgt’s role in biofilm formation or stress response in thermophilic environments.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. Should you require dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
The shelf life of our products depends on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. To avoid degradation, please minimize freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please let us know and we will prioritize its development for your product.
Synonyms
lgt; GTNG_3031; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Geobacillus thermodenitrificans (strain NG80-2)
Target Names
lgt
Target Protein Sequence
MMEPAIEPLDRVFLQLGPITIYWYGVIIGTGVLIGLWLATRESVRRGLPKETFVDLVLFA VPIAIVCARAYYVLFEWDYYSKHLAEIPKIWQGGLAIHGGLIGAVATGAVFAQVRGLPFW KLADIAAPSIILGQAIGRWGNFMNQEAHGGPVSREFLENLYLPDWIINQMYINGQYWHPT FLYESLWNLVGFCLLLWLRRVNLRRGELFLSYVIWYSLGRFWIEGMRTDSLMLAEHLRMA QVMSITLIIIALVLWMVRRAKGWARERYMD
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) from *Geobacillus thermodenitrificans* catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Geobacillus thermodenitrificans and why is its lgt gene of interest to researchers?

Geobacillus thermodenitrificans is a rod-shaped, thermophilic bacterium that has been isolated from high-temperature environments, including well pipeline sediment in Ankara, Turkey where temperatures reach 98°C . This extremophile has attracted significant research attention due to its ability to thrive in harsh conditions and its biotechnological potential for producing thermostable enzymes.

The lgt (prolipoprotein diacylglyceryl transferase) gene encodes an essential enzyme in bacterial lipoprotein biogenesis. In Gram-negative bacteria, Lgt catalyzes the first reaction in the three-step post-translational lipid modification process, transferring diacylglyceryl from phosphatidylglycerol to an invariant cysteine residue in the lipobox motif of prolipoproteins . This modification is critical for bacterial survival, as deletion of the lgt gene is lethal to most Gram-negative bacteria .

The particular interest in G. thermodenitrificans lgt stems from the organism's thermophilic nature. The genome of G. thermodenitrificans subsp. calidus DSM 22629T consists of 3,408,575 bp with 48.94% GC content and contains 3,615 genes, including 3,466 protein-coding genes . Researchers are interested in understanding how this thermophilic variant of lgt maintains functionality at elevated temperatures, which could provide insights into membrane protein thermostability and potentially lead to applications in biotechnology.

How does the structure and function of Lgt differ between thermophilic and mesophilic bacteria?

While specific structural data on G. thermodenitrificans Lgt is not directly available in the search results, we can draw important comparisons based on the well-characterized E. coli Lgt structure and general principles of thermophilic protein adaptation.

In E. coli, Lgt is an integral membrane enzyme with multiple transmembrane helices. Crystal structures of E. coli Lgt reveal the presence of two binding sites and identified critical residues, including Arg143 and Arg239, that are essential for diacylglyceryl transfer . The enzyme contains a periplasmic domain housing the catalytic machinery, with substrates and products entering and leaving laterally relative to the lipid bilayer .

Thermophilic proteins like those from G. thermodenitrificans typically exhibit several structural adaptations compared to their mesophilic counterparts:

  • Increased rigidity and compactness

  • Higher proportion of charged residues forming additional salt bridges

  • More extensive hydrophobic interactions in the protein core

  • Reduced number of thermolabile residues (Asn, Gln)

  • Modified membrane-interacting regions to accommodate higher membrane fluidity at elevated temperatures

These adaptations likely allow G. thermodenitrificans Lgt to maintain structural integrity and catalytic function at temperatures that would denature mesophilic versions of the enzyme. The optimal temperature for other recombinant enzymes from G. thermodenitrificans has been reported to be in the 60-70°C range , suggesting similar thermal optima for its Lgt.

What expression systems are most suitable for recombinant production of G. thermodenitrificans Lgt?

Recommended expression systems and strategies:

Expression SystemAdvantagesSpecial Considerations
E. coli BL21(DE3)High expression levels, well-established protocolsMay require codon optimization, lower expression temperature
E. coli C41(DE3)/C43(DE3)Specifically engineered for membrane proteinsMay improve yield of properly folded protein
E. coli Rosetta strainsSupplies rare tRNAs that may be neededHelpful if G. thermodenitrificans uses rare codons
Geobacillus speciesNative-like membrane environment, thermophilicMore challenging expression system, less developed tools

Several successful expressions of recombinant thermophilic enzymes from G. thermodenitrificans have been reported. For example, the β-xylosidase (XsidB) gene was successfully cloned and expressed in E. coli, yielding a functional enzyme with optimal activity at 60°C and pH 7.0 . This suggests that E. coli can correctly fold at least some G. thermodenitrificans proteins.

For optimal expression of membrane proteins like Lgt, key considerations include:

  • Using lower induction temperatures (16-30°C) to slow protein production and improve folding

  • Optimizing inducer concentration to prevent toxic overexpression

  • Co-expressing molecular chaperones to aid proper folding

  • Including appropriate detergents during membrane extraction and purification

What methodological approaches are recommended for characterizing the catalytic activity of recombinant G. thermodenitrificans Lgt?

Characterizing the catalytic activity of recombinant G. thermodenitrificans Lgt requires specialized approaches that account for both its membrane-bound nature and thermophilic properties.

Recommended methodological approaches:

  • Complementation assays

    • Generate an lgt-conditional depletion strain of E. coli (as described for E. coli Lgt )

    • Transform with G. thermodenitrificans lgt expression construct

    • Assess rescue of growth defect at various temperatures

    • This confirms in vivo functionality of the recombinant enzyme

  • Direct activity assays

    • Develop a gel-mobility assay using fluorescent reporter substrates

    • Adapt the GFP-based assay described for E. coli Lgt , which uses a lipoGFP engineered with the N-terminal 24 amino acids of major outer membrane lipoprotein Lpp precursor

    • Compare activity at different temperatures (30-80°C)

    • Measure kinetic parameters (Km, Vmax, kcat) at optimal temperature

  • Mass spectrometry analysis

    • Identify lipid modifications on target lipoproteins

    • Characterize the lipid composition of transferred diacylglyceryl moieties

    • Compare modification patterns between wild-type and recombinant enzyme

  • Thermostability assessment

    • Determine temperature optima and stability profiles

    • Measure residual activity after pre-incubation at elevated temperatures

    • Compare with mesophilic Lgt enzymes to quantify thermostability advantage

For accurate activity measurement, it's essential to establish proper membrane mimetics (detergent micelles or liposomes) that maintain enzyme stability while allowing substrate accessibility. The crystal structures of E. coli Lgt with phosphatidylglycerol and palmitic acid provide valuable reference points for designing substrate analogs and activity assays .

What site-directed mutagenesis strategies might enhance the catalytic efficiency of G. thermodenitrificans Lgt?

Based on structure-function studies of E. coli Lgt and successful mutagenesis approaches with other G. thermodenitrificans enzymes, several rational design strategies could enhance G. thermodenitrificans Lgt activity.

Key mutagenesis targets and strategies:

  • Catalytic residue optimization

    • Identify and mutate residues corresponding to E. coli Arg143 and Arg239, which are essential for diacylglyceryl transfer

    • Fine-tune positioning of catalytic residues through conservative substitutions

    • Create a catalytically inactive mutant as experimental control

  • Substrate binding pocket modifications

    • Alter residues lining the substrate binding pocket to enhance affinity or specificity

    • Target aromatic residues that may be involved in substrate recognition, similar to the approach used for G. thermodenitrificans L-arabinose isomerase where the aromatic ring at position 164 was found important for activity

    • Modify the size of specific amino acids in the binding pocket, comparable to how amino acid 475 size influenced D-tagatose production in G. thermodenitrificans L-arabinose isomerase

  • Membrane interface optimization

    • Modify residues at the membrane-water interface to enhance substrate accessibility

    • Adjust hydrophobic stretches to optimize membrane interaction under varying temperature conditions

  • Thermostability engineering

    • Introduce additional salt bridges at the protein surface

    • Replace thermolabile residues with more stable alternatives

    • Add disulfide bonds in non-catalytic regions

    • Implement consensus approaches based on multiple thermophilic Lgt sequences

The successful application of site-directed mutagenesis to G. thermodenitrificans L-arabinose isomerase, which improved D-tagatose production yield from 46% to 58% , demonstrates that targeted mutations can significantly enhance the activity of thermophilic enzymes from this organism.

How can researchers address expression challenges specific to G. thermodenitrificans Lgt as a thermophilic membrane protein?

Expressing thermophilic membrane proteins like G. thermodenitrificans Lgt presents distinct challenges that require specialized approaches.

Strategies to address expression challenges:

  • Gene and construct optimization

    • Codon optimization for the expression host

    • Signal sequence engineering for improved membrane targeting

    • Truncation constructs to identify minimal functional domains

    • Addition of solubility-enhancing fusion partners (MBP, SUMO, TrxA)

  • Expression conditions optimization

    • Temperature gradient screening (typically 16-30°C for thermophilic proteins in mesophilic hosts)

    • Inducer concentration titration to prevent toxic accumulation

    • Extended expression times at lower temperatures

    • Evaluation of different media compositions to support membrane protein production

  • Host strain selection

    • E. coli C41(DE3)/C43(DE3) specifically evolved for membrane protein expression

    • Consideration of thermophilic expression hosts like Geobacillus itself

    • Lemo21(DE3) for tunable expression level control

    • strains with reduced proteolytic activity

  • Membrane extraction optimization

    DetergentPropertiesRecommended Concentration
    DDM (n-Dodecyl-β-D-maltoside)Mild nonionic, preserves activity1-2% for extraction, 0.02-0.05% for purification
    LDAO (Lauryldimethylamine oxide)Zwitterionic, good for crystallization0.5-1% for extraction, 0.05-0.1% for purification
    DigitoninVery mild, maintains native interactions1-2% for extraction, 0.1-0.2% for purification
    CHAPSZwitterionic, often used with lipids0.5-1.5% for extraction, 0.1-0.3% for purification

When working with E. coli Lgt, researchers successfully purified the protein for crystallography studies , indicating that membrane extraction and purification of Lgt is feasible with appropriate detergents. For G. thermodenitrificans Lgt, additional considerations regarding thermostability during membrane extraction will be crucial.

How can researchers interpret differences in lipid substrate specificity between G. thermodenitrificans Lgt and mesophilic homologs?

Understanding lipid substrate specificity differences requires combining structural, biochemical, and biophysical approaches to analyze how G. thermodenitrificans Lgt interacts with various lipid substrates.

Methodological approaches for lipid specificity characterization:

  • In vivo complementation studies with varied lipid compositions

    • Express G. thermodenitrificans Lgt in an E. coli lgt-knockout strain

    • Supplement growth media with different lipids to alter cellular lipid composition

    • Analyze resulting lipoprotein modifications by mass spectrometry

    • Compare modification patterns at different temperatures

  • In vitro lipid preference assays

    • Purify recombinant G. thermodenitrificans Lgt using appropriate detergents

    • Reconstitute in liposomes with defined lipid compositions

    • Test activity with different phospholipid donors (including those found in thermophilic membranes)

    • Compare activity profiles between G. thermodenitrificans Lgt and E. coli Lgt

  • Structural analysis of lipid binding

    • Attempt crystallization of G. thermodenitrificans Lgt with various lipid substrates

    • Apply molecular docking to predict lipid binding modes

    • Compare binding pocket architecture with E. coli Lgt, where structures revealed two binding sites for lipid substrates

    • Use structure-guided mutagenesis to validate predicted lipid interaction sites

The thermophilic nature of G. thermodenitrificans likely influences its membrane lipid composition, potentially requiring adaptations in Lgt's substrate recognition. Thermophilic bacteria often contain more saturated fatty acids and longer acyl chains to maintain membrane integrity at elevated temperatures. This may be reflected in G. thermodenitrificans Lgt's substrate preference compared to mesophilic homologs.

What approaches can validate the functional integrity of recombinantly expressed G. thermodenitrificans Lgt?

Ensuring that recombinantly expressed G. thermodenitrificans Lgt maintains its native functional integrity requires multiple validation approaches.

Validation methods for functional integrity:

  • Complementation testing

    • Create an lgt-conditional depletion strain similar to that used for E. coli Lgt

    • Transform with G. thermodenitrificans lgt expression construct

    • Assess rescue of growth phenotype at different temperatures

    • Compare complementation efficiency with native E. coli Lgt

  • Temperature-dependent activity profiling

    • Measure activity across a wide temperature range (30-80°C)

    • Compare observed optimal temperature with G. thermodenitrificans growth temperature

    • Generate Arrhenius plots to characterize activation energy

    • Assess thermal stability through residual activity measurements after heat treatment

  • Structural integrity assessment

    • Circular dichroism spectroscopy to monitor secondary structure

    • Intrinsic fluorescence to assess tertiary structure and thermal unfolding

    • Limited proteolysis to identify properly folded domains

    • Size-exclusion chromatography to confirm proper oligomeric state

  • Product verification

    • Mass spectrometry analysis of lipid-modified substrates

    • Comparison of modification patterns with those generated by native enzyme

    • Verification that the diacylglyceryl moiety has been correctly transferred

For successful validation, researchers should consider that the E. coli Lgt demonstrated clear diacylglyceryl transferase activity when assessed using a GFP-based assay , providing a established methodological approach that could be adapted for the thermophilic variant.

How does the genetic context and evolution of the lgt gene in G. thermodenitrificans compare to other bacteria?

Understanding the evolutionary context of G. thermodenitrificans lgt provides insights into its specialized adaptations and functional significance.

Comparative genomic approaches:

This comparative analysis would build upon the taxonomic analysis already performed for G. thermodenitrificans subsp. calidus DSM 22629T, which confirmed its placement within the G. thermodenitrificans clade with high support .

What are the implications of G. thermodenitrificans Lgt structure for understanding general principles of thermostable membrane protein design?

Understanding the structural basis of G. thermodenitrificans Lgt thermostability could provide valuable insights for engineering other thermostable membrane proteins.

Key structural principles and research approaches:

  • Membrane-water interface adaptations

    • Analyze distribution of charged and polar residues at the membrane interface

    • Compare with mesophilic homologs to identify thermophilic adaptations

    • Examine how these adaptations accommodate membrane fluidity changes at elevated temperatures

    • Test these principles through rational design of other membrane proteins

  • Transmembrane domain stabilization

    • Identify specific packing motifs in transmembrane helices

    • Analyze interhelical interactions that may contribute to thermostability

    • Compare helix length and composition with mesophilic homologs

    • Evaluate the role of specific amino acid preferences in thermostable transmembrane domains

  • Active site temperature adaptations

    • Compare active site geometry with mesophilic E. coli Lgt

    • Analyze how catalytic residues are positioned to maintain function at elevated temperatures

    • Examine whether there are thermophilic-specific substrate binding adaptations

    • Consider how protein dynamics at high temperatures impacts catalysis

  • General thermostabilizing principles

    • Increased salt bridges and electrostatic networks

    • Enhanced hydrophobic packing in protein core

    • Shortened loop regions

    • Reduction in thermolabile residues (Asn, Gln, Met, Cys)

The crystal structures of E. coli Lgt provide an excellent template for comparative modeling and analysis of G. thermodenitrificans Lgt. By mapping sequence differences onto this structural framework, researchers can identify potentially important thermostabilizing adaptations.

How might recombinant G. thermodenitrificans Lgt be applied in synthetic biology for thermostable lipoprotein production?

The thermal stability of G. thermodenitrificans Lgt opens possibilities for novel biotechnological applications in synthetic biology.

Potential applications and approaches:

  • Thermostable surface display systems

    • Engineer heat-stable lipoprotein anchoring systems for enzyme immobilization

    • Develop thermophilic whole-cell catalysts with surface-displayed enzymes

    • Create biosensors functional at elevated temperatures

    • Design thermally robust bacterial adhesion modules

  • Synthetic lipoprotein production platform

    • Establish expression systems for producing custom lipid-modified proteins at elevated temperatures

    • Engineer synthetic lipidation pathways combining elements from different thermophiles

    • Develop high-temperature compatible membrane protein production systems

    • Create thermostable vaccine components with lipid adjuvant properties

  • Methodological development approaches

    • Design synthetic thermostable lipobox sequences optimized for G. thermodenitrificans Lgt

    • Create modular expression systems combining the three lipoprotein processing enzymes from thermophiles

    • Develop high-throughput screening methods for identifying optimal lipidation conditions

    • Engineer chimeric enzymes combining features from different thermophilic lipid-modifying enzymes

G. thermodenitrificans already shows promise for biotechnological applications, producing thermostable enzymes like alpha-glucosidase that functions at high temperatures . The Lgt enzyme could expand this toolkit to include technologies for thermostable membrane protein anchoring and lipoprotein engineering.

What are the critical controls and validations required when working with recombinant G. thermodenitrificans Lgt?

Rigorous experimental design and appropriate controls are essential when working with this challenging enzyme system.

Essential experimental controls and validations:

  • Expression and purification controls

    • Empty vector control to verify specific expression

    • Catalytically inactive mutant (based on E. coli Arg143/Arg239 equivalents )

    • Western blot confirmation of expression

    • Mass spectrometry verification of purified protein identity

  • Activity assay controls

    • Thermal denaturation control (heat-inactivated enzyme)

    • E. coli Lgt as positive control for comparison

    • No-enzyme control to establish background

    • Detergent-only control to rule out non-enzymatic effects

  • Substrate specificity validations

    Validation TestMethodExpected Outcome
    Lipobox sequence specificityTest multiple prolipoprotein substratesPreference pattern that may differ from mesophilic Lgt
    Phospholipid donor specificityCompare activity with different phospholipidsMay show adaptation to thermophilic membrane lipids
    Temperature dependenceActivity profile across 30-80°CBell-shaped curve with optimum near G. thermodenitrificans growth temperature
    pH profileActivity measurement across pH rangeMay differ from mesophilic enzymes due to different ionization states at high temperatures
  • Functional validation

    • Complementation in lgt-deletion strain

    • Testing in different expression hosts to rule out host-specific effects

    • In vivo activity assessment through lipoprotein modification patterns

    • Comparison of kinetic parameters with well-characterized mesophilic Lgt

The successful application of these controls and validations will ensure reliable characterization of G. thermodenitrificans Lgt and facilitate comparisons with other Lgt enzymes, such as the well-studied E. coli variant for which crystal structures and functional data are available .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.