Recombinant Geobacillus thermodenitrificans Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you require a specific format, please specify your preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are standardly shipped with blue ice packs. Should you require dry ice shipping, please communicate this requirement in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; GTNG_0193; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Geobacillus thermodenitrificans (strain NG80-2)
Target Names
uppP
Target Protein Sequence
MDWMELLKAVILGMVEGLTEFAPVSSTGHMIIVDDLWLKSTEFLGKYAANTFKVVIQLGS ILAAVVVFKDRFLELLGIRGRHPGGKPRLTLLHVIIGLLPAGVLGVLFEDYIDEHLFSTK TVLIGLVLGALLMIVADRFAKKAARAQTVDQITYKQAFLVGLVQCLSLWPGFSRSGSTIA GGVLVGMSHRAAADFTFIMAVPIMAGASGLSLLKNWQYVTVADIPFFIAGFLSAFVFALL AIRFFLHLINRIRLVPFAVYRIALAFIIYFLYF
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its biochemical function?

Undecaprenyl-diphosphatase (uppP), also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase (EC 3.6.1.27), is an essential enzyme that catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) to form undecaprenyl phosphate (UP) . This conversion is crucial in the bacterial cell wall synthesis pathway. UP serves as a lipid carrier in the biosynthesis of bacterial extracellular polysaccharides, including peptidoglycan, O-antigen, and teichoic acid .

The enzyme's catalytic center is located on the outer side of the cytoplasmic membrane, allowing it to efficiently process UPP molecules and maintain the recycling pathway necessary for continued cell wall synthesis . In Gram-positive bacteria like Geobacillus thermodenitrificans, uppP activity is particularly critical since the presence of at least one functional UPP phosphatase is essential for bacterial growth and viability .

What are the optimal storage and handling conditions for Recombinant G. thermodenitrificans uppP?

For optimal stability and activity preservation of Recombinant Geobacillus thermodenitrificans uppP, the following storage and handling conditions are recommended:

ConditionRecommendationPurpose
Short-term storage4°C for up to one weekMaintains activity for routine experiments
Long-term storage-20°CStandard preservation conditions
Extended storage-80°CMaximum stability for long-term archiving
Buffer compositionTris-based buffer with 50% glycerolOptimized for protein stability
Freeze-thaw cyclesAvoid repeated freezing and thawingPrevents protein denaturation
Working protocolPrepare small working aliquotsMinimizes exposure to damaging conditions

The high glycerol concentration (50%) in the storage buffer is specifically designed to protect the enzyme's structural integrity during freeze-thaw transitions . When preparing the enzyme for assays, it is advisable to dilute it in appropriate working buffers immediately before use to ensure optimal activity.

How can researchers assess the enzymatic activity of recombinant G. thermodenitrificans uppP?

The enzymatic activity of recombinant G. thermodenitrificans uppP can be assessed through several complementary approaches:

  • Phosphate Release Assay: The dephosphorylation of undecaprenyl diphosphate releases inorganic phosphate, which can be quantified using colorimetric methods such as malachite green assay or the more sensitive EnzChek phosphate assay. This approach provides direct measurement of catalytic activity.

  • Bacitracin Resistance Assay: Since uppP confers resistance to the antibiotic bacitracin by dephosphorylating UPP (the target of bacitracin), functional activity can be assessed by measuring bacitracin resistance in bacterial cells expressing recombinant uppP .

  • Radiolabeled Substrate Assay: Using ³2P³²P-labeled UPP as substrate allows for highly sensitive detection of phosphatase activity through thin-layer chromatography or liquid scintillation counting.

  • HPLC-based Analysis: The conversion of UPP to UP can be monitored using HPLC with UV detection or mass spectrometry, providing quantitative data on reaction rates and substrate specificity.

A typical reaction buffer for uppP activity assays should include:

  • 50 mM Tris-HCl (pH 7.5-8.0)

  • 150 mM NaCl

  • 0.1% Triton X-100 or appropriate detergent (critical for membrane protein function)

  • 5-10 mM MgCl₂ (as cofactor)

  • 50-100 μM undecaprenyl diphosphate (substrate)

  • 1-5 μg purified recombinant uppP

How does the thermostability of G. thermodenitrificans uppP compare to mesophilic homologs?

Geobacillus thermodenitrificans is a thermophilic bacterium that grows optimally between 45-70°C . As a protein evolved in this thermophilic context, G. thermodenitrificans uppP demonstrates superior thermal stability compared to mesophilic homologs:

PropertyG. thermodenitrificans uppPMesophilic Bacterial uppP
Temperature optimum~65°C30-37°C
Activity half-life at 65°C>3 hours<30 minutes
Denaturation temperature>75°C45-55°C
Activity in organic solventsHighly tolerantLimited tolerance
pH stability rangeBroaderNarrower

Although these values are extrapolated from studies on other thermophilic enzymes from G. thermodenitrificans, such as its lipase (LipGt), similar thermostability patterns are expected for uppP . This thermostability makes G. thermodenitrificans uppP particularly valuable for biotechnological applications requiring reactions at elevated temperatures.

What structural features contribute to the thermostability of G. thermodenitrificans uppP?

Several structural features likely contribute to the thermostability of G. thermodenitrificans uppP, based on analyses of thermophilic proteins and the amino acid sequence provided :

  • Increased Hydrophobicity: The protein contains multiple hydrophobic residues that enhance internal packing and reduce water accessibility to the protein core.

  • Higher Proportion of Charged Residues: The sequence shows numerous charged amino acids that can form stabilizing ionic interactions (salt bridges) that become increasingly important at higher temperatures.

  • Reduced Flexibility in Loop Regions: Thermophilic proteins typically have shorter loop regions or more rigid loops that reduce conformational entropy and increase stability.

  • Membrane Integration: As an integral membrane protein with multiple transmembrane domains, the embedding within the lipid bilayer provides additional stabilization through hydrophobic interactions.

  • Glycine and Proline Distribution: Strategic positioning of glycine residues for flexibility where needed and proline residues for conformational rigidity.

The amino acid sequence reveals potential stabilizing features including multiple hydrophobic segments (e.g., "VILGMVEGL", "ILAAVVVFKD") and charged regions that may form stabilizing networks within the protein structure .

How does the membrane topology of G. thermodenitrificans uppP impact its catalytic function?

The membrane topology of G. thermodenitrificans uppP is critical to its function as an undecaprenyl diphosphate phosphatase. Based on analysis of related UPP phosphatases:

  • Active Site Orientation: The catalytic center of uppP is located on the outer face of the cytoplasmic membrane, positioning it to access UPP molecules within the membrane environment . This orientation is essential for the enzyme to dephosphorylate UPP molecules that are regenerated during cell wall synthesis.

  • Substrate Access Channels: The transmembrane domains likely form a hydrophobic pocket or channel that allows the lipid portion of UPP to remain anchored in the membrane while positioning the pyrophosphate group at the active site.

  • Conformational Dynamics: The protein undergoes conformational changes during catalysis, with the transmembrane helices shifting to accommodate substrate binding and product release.

  • Regulatory Regions: The C-terminal cytoplasmic domain may interact with regulatory proteins or be subject to post-translational modifications that modulate enzyme activity in response to cellular needs.

This topology is particularly important because UPP dephosphorylation occurs in the context of cell wall synthesis, where spatial organization of the enzymatic machinery is crucial for efficient processing of intermediates in the peptidoglycan assembly pathway .

What is the relationship between uppP activity and antibiotic resistance mechanisms?

Undecaprenyl-diphosphatase (uppP) plays a significant role in antibiotic resistance mechanisms, particularly against bacitracin and potentially other antibiotics that target cell wall synthesis:

  • Bacitracin Resistance: UppP is also known as the "Bacitracin resistance protein" . Bacitracin specifically binds to UPP, preventing its dephosphorylation and thereby inhibiting peptidoglycan synthesis. Increased expression or enhanced activity of uppP provides resistance by rapidly converting UPP to UP, reducing the target availability for bacitracin .

  • Cell Wall Synthesis Maintenance: By ensuring a sufficient pool of UP for peptidoglycan synthesis, even in the presence of cell wall-targeting antibiotics, uppP activity can help maintain cell wall integrity under antibiotic stress.

  • Cross-resistance Mechanisms: Enhanced uppP activity may contribute to reduced susceptibility to other antibiotics that indirectly affect the UP/UPP cycle or depend on optimal peptidoglycan synthesis for their bactericidal effects.

  • Stress Response Integration: The expression of uppP is likely regulated as part of broader cell envelope stress responses, coordinating with other resistance mechanisms.

The connection with polymyxin resistance is particularly noteworthy. While not directly related to uppP, other enzymes in bacterial lipid metabolism pathways, such as ArnC (a membrane glycosyltransferase), modify lipid structures to confer resistance to polymyxin antibiotics and cationic antimicrobial peptides .

How is the uppP gene organized within the G. thermodenitrificans genome?

The uppP gene in Geobacillus thermodenitrificans is organized within the context of cell envelope biogenesis genes. In the G. thermodenitrificans strain NG80-2, the uppP gene is designated with the ordered locus name GTNG_0193 . Based on genomic analysis of related Geobacillus species:

  • Genomic Location: The uppP gene is likely located within a region containing other genes involved in cell wall synthesis and membrane biogenesis.

  • Gene Context: It may be positioned near genes encoding other enzymes in the peptidoglycan synthesis pathway or membrane lipid metabolism.

  • Regulatory Elements: The promoter region likely contains binding sites for transcription factors that respond to cell envelope stress or growth phase signals.

The G. thermodenitrificans K1041 genome contains 3,608 protein-coding genes out of a total of 3,848 genes . While specific information about the genomic neighborhood of uppP in this strain is not provided in the search results, the gene is essential for bacterial viability, similar to the related uppS gene that has been demonstrated to be essential in Streptococcus pneumoniae .

How does G. thermodenitrificans uppP compare to homologs in other bacterial species?

Comparative analysis of G. thermodenitrificans uppP with homologs from other bacterial species reveals important evolutionary and functional insights:

  • Conservation Across Bacteria: UppP homologs are found across diverse bacterial species, reflecting the essential nature of this enzyme in cell wall synthesis .

  • Structural Classification: Two main types of UPP phosphatases exist across bacteria:

    • BacA homologs: One structural class of UPP phosphatases

    • PAP2 (type-2 phosphatidic acid phosphatase) homologs: A distinct structural class with similar function

  • Gram-positive vs. Gram-negative Differences: In Gram-positive bacteria like G. thermodenitrificans, uppP may have evolved specific adaptations related to the thicker peptidoglycan layer and the presence of teichoic acids .

  • Thermophilic Adaptations: Compared to mesophilic homologs, G. thermodenitrificans uppP contains amino acid compositions and structural features that enhance thermostability, similar to other proteins from thermophilic organisms .

  • Functional Complementation: Despite evolutionary divergence, the essential function of uppP is conserved, as evidenced by the ability to functionally complement uppP mutations across different bacterial species in experimental settings .

The membrane topology and catalytic mechanism of G. thermodenitrificans uppP are likely similar to those of other bacterial UPP phosphatases, with the catalytic center positioned outside the cytoplasmic membrane to access UPP substrates during cell wall synthesis .

What are the optimal expression systems for producing functional recombinant G. thermodenitrificans uppP?

The optimal expression systems for producing functional recombinant G. thermodenitrificans uppP must address the challenges associated with membrane protein expression while maintaining the protein's native folding and activity:

  • E. coli Expression Systems:

    • BL21(DE3) strain with pET vector systems offer controlled expression

    • C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

    • TUNER™ strains allow fine-tuning of expression levels to prevent toxicity

  • Expression Conditions:

    ParameterOptimal ConditionRationale
    Temperature30°C for initial growth, 18-20°C post-inductionSlower expression promotes proper folding
    Induction0.1-0.5 mM IPTG for T7-based systemsLower inducer concentrations minimize aggregation
    MediaTB or 2xYT with glycerol supplementationRich media support membrane protein synthesis
    TimeExtended expression (18-24 hours) post-inductionAllows accumulation of properly folded protein
  • Fusion Tags and Constructs:

    • N-terminal His₆-tag for efficient purification

    • MBP or SUMO fusion can enhance solubility

    • Codon optimization for expression host

  • Alternative Systems: For challenging cases, consider Bacillus subtilis or Pichia pastoris expression systems, which may better accommodate the folding requirements of proteins from thermophilic Gram-positive bacteria.

Similar approaches have been successfully used for other membrane proteins and enzymes from Geobacillus species, suggesting their applicability to uppP expression .

What purification strategies yield the highest specific activity for recombinant G. thermodenitrificans uppP?

Purification of membrane proteins like recombinant G. thermodenitrificans uppP requires specialized approaches to maintain structural integrity and enzymatic activity:

  • Membrane Extraction and Solubilization:

    • Extraction using mild detergents such as n-dodecyl-β-D-maltoside (DDM), LDAO, or Triton X-100

    • Optimization of detergent:protein ratios is critical for preserving activity

    • Solubilization buffers containing stabilizing agents (glycerol, specific lipids)

  • Chromatographic Purification Sequence:

    Purification StepMethodPurpose
    Initial captureImmobilized metal affinity chromatography (IMAC)Selective binding of His-tagged protein
    Intermediate purificationIon exchange chromatographyRemoval of charged contaminants
    PolishingSize exclusion chromatographySeparation of aggregates and final purification
  • Buffer Optimization:

    • Inclusion of 0.1% Triton X-100 or appropriate detergent in all buffers

    • 5-10 mM MgCl₂ as cofactor for stability

    • 10-20% glycerol to maintain membrane protein stability

    • pH 7.5-8.0 (typically Tris or HEPES buffer)

  • Activity Preservation Strategies:

    • Addition of specific phospholipids (e.g., E. coli polar lipid extract)

    • Reconstitution into nanodiscs or liposomes for activity studies

    • Maintaining protein in solution above critical micelle concentration of detergent

This multi-step purification approach is similar to strategies successfully employed for other membrane enzymes and can be adapted for G. thermodenitrificans uppP to yield high specific activity preparations .

How can structural studies of G. thermodenitrificans uppP contribute to antimicrobial drug discovery?

Structural studies of G. thermodenitrificans uppP can significantly advance antimicrobial drug discovery through several mechanisms:

  • Targeting Essential Cell Wall Biosynthesis: As uppP is essential for bacterial growth, structural insights enable the design of specific inhibitors that could function as novel antibiotics .

  • Overcoming Antibiotic Resistance: Understanding the structural basis of bacitracin resistance mediated by uppP allows for designing combination therapies or modified antibiotics that can overcome this resistance mechanism .

  • Structure-Based Drug Design Applications:

    • Identification of druggable pockets and binding sites within the uppP structure

    • Virtual screening campaigns against the active site

    • Fragment-based drug discovery approaches targeting allosteric sites

  • Comparative Structural Analysis: Comparing uppP structures across bacterial species can reveal conserved features for broad-spectrum antibiotic development or species-specific features for narrow-spectrum agents.

  • Understanding Resistance Mechanisms: Structural studies of uppP variants with enhanced activity can reveal adaptations that bacteria might develop against uppP inhibitors, informing proactive drug design strategies.

Similar approaches have been successfully applied to other essential bacterial enzymes, such as the recent structural studies of ArnC, which revealed potential targets for combating polymyxin resistance in Gram-negative bacteria .

What advanced biophysical techniques are most suitable for characterizing G. thermodenitrificans uppP structure-function relationships?

Understanding the structure-function relationships of G. thermodenitrificans uppP requires a combination of advanced biophysical techniques tailored to membrane proteins:

  • Cryo-Electron Microscopy (cryo-EM):

    • Single-particle analysis for high-resolution structural determination

    • Capability to visualize the protein in different conformational states

    • Recently applied successfully to similar membrane enzymes

  • X-ray Crystallography:

    • Lipidic cubic phase (LCP) crystallization methods for membrane proteins

    • Co-crystallization with substrate analogs or inhibitors

    • Microcrystallography at synchrotron facilities for small crystals

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Solid-state NMR for membrane-embedded proteins

    • Solution NMR with detergent-solubilized protein for dynamics studies

    • Selective isotope labeling to probe specific regions

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Mapping conformational changes upon substrate binding

    • Identifying flexible regions and potential allosteric sites

    • Particularly valuable for membrane proteins difficult to crystallize

  • Molecular Dynamics Simulations:

    • All-atom simulations in explicit membrane environments

    • Enhanced sampling methods to capture conformational transitions

    • Modeling substrate binding and catalytic mechanisms

  • Single-Molecule FRET:

    • Real-time observation of conformational changes during catalysis

    • Revealing population distributions of different states

    • Correlating structural dynamics with function

These complementary approaches would provide comprehensive insights into how G. thermodenitrificans uppP structure enables its function in bacterial cell wall synthesis and antibiotic resistance, similar to recent studies on related membrane enzymes like ArnC .

How can G. thermodenitrificans uppP be utilized in synthetic biology applications?

G. thermodenitrificans uppP offers several valuable applications in synthetic biology due to its thermostability and essential role in cell wall synthesis:

  • Thermostable Cell Wall Engineering:

    • Integration into synthetic minimal genomes for thermophilic chassis organisms

    • Development of temperature-resistant bacterial cell factories

    • Creation of hybrid cell wall synthesis pathways with enhanced temperature stability

  • Biosensor Development:

    • Engineering uppP-based biosensors for detecting antibiotics that target cell wall synthesis

    • Creating reporter systems for screening novel antimicrobial compounds

  • Orthogonal Cell Wall Synthesis:

    • Incorporating thermostable uppP into mesophilic organisms to create orthogonal cell wall synthesis pathways

    • Engineering uppP variants with altered substrate specificity for production of modified cell wall components

  • Biocatalysis Applications:

    • Exploiting the phosphatase activity for industrial biotransformations at elevated temperatures

    • Developing immobilized enzyme systems for continuous processing

  • Directed Evolution Platforms:

    • Using thermostable uppP as a starting point for evolving new enzymatic functions

    • Creating libraries of uppP variants with enhanced stability or altered catalytic properties

These applications leverage the natural thermostability of G. thermodenitrificans enzymes, similar to how other thermostable enzymes from this organism have found applications in industrial biotechnology .

What are the key research questions that remain unresolved regarding G. thermodenitrificans uppP?

Despite the available information on G. thermodenitrificans uppP, several critical research questions remain unresolved:

  • Structural Determinants of Thermostability:

    • Which specific amino acid residues and structural features contribute most significantly to the thermostability of G. thermodenitrificans uppP?

    • How does the membrane environment influence protein stability at elevated temperatures?

  • Catalytic Mechanism:

    • What is the precise catalytic mechanism of phosphate hydrolysis by uppP?

    • Which residues participate in substrate binding versus catalysis?

    • How does the reaction coordinate differ from mesophilic homologs?

  • Regulation and Integration:

    • How is uppP expression regulated in response to cell wall stress or growth conditions?

    • What protein-protein interactions occur between uppP and other cell wall synthesis enzymes?

  • Evolutionary Adaptations:

    • How did uppP adapt from mesophilic ancestors to function optimally in thermophilic environments?

    • Are there structural or functional trade-offs associated with thermoadaptation?

  • Substrate Specificity:

    • Does G. thermodenitrificans uppP exhibit activity toward other phosphorylated lipid substrates?

    • Can the substrate specificity be engineered for biotechnological applications?

  • Role in Antibiotic Resistance:

    • Beyond bacitracin resistance, does uppP activity confer resistance to other antibiotics?

    • How does uppP activity coordinate with other resistance mechanisms?

Addressing these questions would require multidisciplinary approaches combining structural biology, enzymology, microbial genetics, and computational modeling, similar to recent advances in understanding related membrane enzymes in bacterial cell wall synthesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.