Recombinant Geobacillus thermodenitrificans UPF0059 membrane protein GTNG_3319 (GTNG_3319)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Kindly consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate your request in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; GTNG_3319; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Geobacillus thermodenitrificans (strain NG80-2)
Target Names
mntP
Target Protein Sequence
MGALIGEMIALSLMALALGMDAFSVALGMGLLRLRLRQIFYIGLTIGLFHIFMPLVGMAV GRFLSREFGSIATYAGGVLLLWLGGQMIVTSFQQEEGTSFLPHGAGLLFFAFSVSLDSFS VGLSLGIFGARTMATILLFGLFSTVLTWIGLLVGRHFRQWLGSYSEALGGSILLVFGLKL LFS
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the predicted functional role of GTNG_3319 as MntP?

GTNG_3319 (also known as MntP) is annotated as a putative manganese efflux pump, suggesting its primary role in manganese homeostasis within Geobacillus thermodenitrificans . The protein likely functions by:

  • Facilitating the movement of Mn²⁺ ions from the cytoplasm to the extracellular environment

  • Helping to protect the cell from manganese toxicity while maintaining sufficient levels for essential cellular processes

  • Working in concert with manganese import systems to maintain proper metal homeostasis

This role is particularly important in thermophilic bacteria that may encounter variable metal availability in their high-temperature environments. Experimental verification would typically involve metal transport assays, growth studies under varying manganese concentrations, and comparison with characterized manganese transport systems.

How does GTNG_3319 compare to other membrane proteins in thermophilic organisms?

As a protein from Geobacillus thermodenitrificans, GTNG_3319 likely exhibits thermostability adaptations similar to other proteins from this organism. Thermophilic proteins generally feature:

  • Increased hydrophobic core packing

  • Enhanced ionic interactions (salt bridges)

  • Higher proportion of amino acids that contribute to structural rigidity

  • Decreased occurrence of thermolabile residues

These adaptations enable GTNG_3319 to function effectively at the elevated temperatures (45-70°C) at which G. thermodenitrificans grows optimally . Unlike mesophilic membrane proteins, which might denature at such temperatures, GTNG_3319 maintains its structural integrity and functional activity. This thermostability makes it particularly valuable for research applications requiring heat-resistant proteins or for understanding evolutionary adaptations to extreme environments.

What are the optimal expression and purification protocols for recombinant GTNG_3319?

The optimal expression and purification protocol for GTNG_3319 involves several methodological steps:

  • Expression System: The protein is typically expressed in E. coli with an N-terminal His-tag .

  • Purification Method: Affinity chromatography using the His-tag, with purity typically exceeding 90% as determined by SDS-PAGE .

  • Expression Optimization: For membrane proteins like GTNG_3319, consider:

    • Testing different E. coli strains specialized for membrane protein expression

    • Optimizing induction conditions (temperature, IPTG concentration, induction time)

    • Co-expressing with chaperones to improve folding

  • Solubilization: Careful selection of detergents compatible with downstream applications, considering whether the protein will be reconstituted into liposomes for functional studies.

  • Quality Assessment: SDS-PAGE and potentially functional assays to verify protein integrity before experimental use.

This methodological approach maximizes yield while maintaining the structural and functional integrity of the protein.

What are the recommended storage conditions for maintaining GTNG_3319 stability?

For optimal stability and retention of functional activity, GTNG_3319 should be stored according to these guidelines:

  • Long-term Storage: The lyophilized protein powder should be stored at -20°C/-80°C upon receipt .

  • Buffer Composition: When reconstituted, the protein is typically maintained in a Tris/PBS-based buffer (pH 8.0) containing 6% trehalose as a stabilizing agent .

  • Reconstitution Protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • For samples intended for storage, add glycerol to 5-50% final concentration (50% recommended)

  • Working Solutions: Aliquots can be maintained at 4°C for up to one week for ongoing experiments .

  • Avoiding Degradation: Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity .

These storage conditions are designed to maintain protein integrity and functional activity while minimizing degradation over time.

How can native mass spectrometry be utilized to study GTNG_3319-lipid interactions?

Native mass spectrometry (nMS) offers powerful capabilities for investigating membrane protein-lipid interactions that could be applied to GTNG_3319:

  • Direct Analysis from Liposomes: GTNG_3319 can be studied directly from intact liposomes with customizable lipid compositions, allowing observation of protein-lipid interactions in a near-native environment .

  • Identification of Bound Lipids: nMS can determine the specific lipids that bind to GTNG_3319, providing insights into lipid preferences that may be critical for proper folding, stability, or function .

  • Membrane Context Analysis: By reconstituting GTNG_3319 in liposomes mimicking different cellular membranes (e.g., plasma membrane vs. internal membranes), researchers can investigate how membrane context influences lipid binding specificity .

  • Chemical vs. Biophysical Effects: The methodology allows researchers to distinguish whether specific lipid effects on GTNG_3319 arise from direct chemical interactions or indirectly through altered membrane properties (curvature, fluidity, charge) .

  • Ejection Optimization: Depending on the strength of protein-lipid interactions, GTNG_3319 may require supercharging agents for effective ejection from the membrane during nMS analysis .

This approach provides molecular-level insights into how the membrane environment affects GTNG_3319 structure and function.

How does membrane composition affect GTNG_3319 function and stability?

The lipid environment likely plays a crucial role in modulating GTNG_3319 function and stability through several mechanisms:

  • Lipid-Dependent Activity: Similar to other membrane transporters, the transport efficiency of GTNG_3319 may be modulated by specific lipid compositions. Certain lipids might be required for optimal function through direct binding or effects on protein conformation .

  • Thermostability Mechanisms: The membrane environment contributes to the thermostability of GTNG_3319, with specific lipid compositions potentially enhancing protein stability at elevated temperatures characteristic of G. thermodenitrificans growth .

  • Membrane Physical Properties: Beyond specific lipid interactions, broader membrane properties such as fluidity, thickness, curvature, and charge may influence GTNG_3319 function and can be systematically studied using the liposome-nMS platform .

Table 1: Potential membrane environmental factors affecting GTNG_3319

PropertyPotential Effect on GTNG_3319Experimental Approach
Lipid head groupsElectrostatic interactions, hydrationVary phospholipid composition
Acyl chain lengthHydrophobic matching with TMDsSystematic chain length series
Membrane fluidityConformational flexibilityCholesterol/ergosterol titration
Membrane tensionTransport kineticsOsmotic stress experiments
Membrane chargeElectrostatic interactionsVarying charged lipid content

Investigating these aspects would require reconstituting GTNG_3319 in various membrane mimetics with defined compositions, followed by functional and structural characterization.

What experimental approaches can elucidate GTNG_3319's manganese transport mechanism?

Several experimental strategies can be employed to characterize the manganese transport mechanism of GTNG_3319:

  • Transport Assays:

    • Reconstitution of GTNG_3319 into liposomes with entrapped fluorescent manganese indicators

    • Isotope-based transport assays using radioactive manganese (⁵⁴Mn)

    • Stopped-flow kinetic measurements to determine transport rates

  • Structural Studies:

    • Site-directed mutagenesis of predicted metal-binding residues

    • Cryo-EM or X-ray crystallography to resolve protein structure with and without bound manganese

    • Molecular dynamics simulations to predict conformational changes during transport

  • Metal Specificity Analysis:

    • Competition assays with other divalent metals

    • Binding affinity measurements using isothermal titration calorimetry

    • Effect of manganese concentration on transport kinetics

  • Electrophysiological Approaches:

    • Patch-clamp studies on reconstituted proteoliposomes

    • Solid-supported membrane electrophysiology to measure charge movement

  • In Vivo Functional Studies:

    • Expression in manganese-sensitive bacterial strains

    • Complementation assays with known manganese transporter mutants

    • Gene deletion/silencing to assess physiological role

These complementary approaches would provide a comprehensive understanding of how GTNG_3319 mediates manganese transport across membranes.

How can GTNG_3319 be studied across different membrane environments mimicking cellular trafficking pathways?

To study GTNG_3319 across different membrane environments, researchers can adapt methodologies described for other membrane proteins:

  • Organelle-Mimicking Liposomes: Create liposomes with lipid compositions that mimic different bacterial membrane microdomains or eukaryotic organelles (if studying the protein in heterologous systems) .

  • Liposome-nMS Platform: Use native mass spectrometry to directly study GTNG_3319 from these different membrane environments, revealing how lipid binding specificity changes with membrane context .

  • Fluorescence Microscopy Approaches:

    • Reconstitute fluorescently-labeled GTNG_3319 in giant unilamellar vesicles (GUVs) with domain-forming lipid mixtures

    • Monitor protein partitioning between ordered and disordered domains

    • Track membrane protein lateral diffusion using approaches like FRAP or single-particle tracking

  • Systematic Variation of Membrane Properties:

    • Study GTNG_3319 in membranes with systematically varied curvature

    • Examine effects of membrane thickness on protein function

    • Assess influence of membrane charge on protein orientation

This approach recognizes that membrane proteins like GTNG_3319 may display different behaviors in different membrane environments, allowing researchers to understand context-dependent function .

What are common challenges in functional assays with GTNG_3319 and how can they be addressed?

Researchers may encounter several challenges when conducting functional assays with GTNG_3319:

  • Protein Orientation in Liposomes:

    • Challenge: Random orientation resulting in mixed transport directionality

    • Solution: Use asymmetric reconstitution protocols or pH-jump methods to promote unidirectional insertion

  • Distinguishing Binding from Transport:

    • Challenge: Separating manganese binding events from actual transport

    • Solution: Time-resolved measurements and transport assays with membrane-impermeable chelators

  • Signal-to-Noise Ratio:

    • Challenge: Weak signals in transport assays

    • Solution: Optimize protein:lipid ratios, use more sensitive detection methods, or incorporate signal amplification steps

  • Maintaining Activity After Reconstitution:

    • Challenge: Loss of transport activity following detergent removal

    • Solution: Screen multiple detergents and reconstitution methods, include stabilizing lipids, optimize buffer conditions

  • Controlling for Leakage:

    • Challenge: Non-specific leakage of ions across liposome membranes

    • Solution: Include protein-free liposome controls, optimize lipid composition for reduced leakage, use appropriate internal controls

Addressing these challenges requires systematic optimization and appropriate controls to ensure reliable functional characterization.

What controls are essential for experiments investigating GTNG_3319's manganese transport activity?

Robust experimental design for GTNG_3319 functional studies requires several essential controls:

  • Negative Controls:

    • Protein-free liposomes to establish baseline leakage/passive diffusion

    • Heat-denatured GTNG_3319 to confirm transport is protein-dependent

    • Liposomes with unrelated membrane proteins to control for non-specific effects

  • Specificity Controls:

    • Transport assays with metals other than manganese to establish selectivity

    • Competition assays with varying ratios of manganese to other metals

    • Inclusion of known manganese transport inhibitors

  • Mechanistic Controls:

    • pH gradient manipulations to assess energy coupling mechanisms

    • Membrane potential modulation to determine electrogenic nature of transport

    • Temperature series to establish thermodynamic parameters

  • Protein Quality Controls:

    • SDS-PAGE before reconstitution to verify protein integrity

    • Circular dichroism to confirm proper folding

    • Site-directed mutants of predicted key residues as specificity controls

  • Membrane Environment Controls:

    • Systematic variation of lipid composition to assess lipid requirements

    • Membrane fluidity modifiers to evaluate physical property dependencies

    • Curvature-inducing lipids to assess geometrical constraints

These controls provide a framework for distinguishing specific GTNG_3319 activity from background effects and establish the conditions under which the protein functions optimally.

How can protein stability be maintained during advanced experimental applications?

Maintaining GTNG_3319 stability during complex experimental protocols requires multiple strategies:

  • Buffer Optimization:

    • Include stabilizing agents like trehalose (already used in storage buffer) or glycerol

    • Maintain pH near the optimal range (likely pH 7-8 based on the protein's natural environment)

    • Test different buffer systems for compatibility with specific experimental techniques

  • Membrane Mimetic Selection:

    • Choose detergents that preserve native-like folding (mild non-ionic or zwitterionic detergents)

    • Consider nanodiscs or styrene-maleic acid lipid particles (SMALPs) for detergent-free extraction

    • Optimize protein:lipid ratios in reconstituted systems

  • Temperature Management:

    • Leverage the thermostable nature of GTNG_3319 when appropriate

    • Develop assay conditions that balance thermal stability with experimental requirements

    • Consider the thermal history of the sample in experimental design

  • Oxidation Prevention:

    • Include reducing agents if the protein contains sensitive cysteine residues

    • Purge buffers with nitrogen when preparing samples for oxygen-sensitive experiments

    • Minimize exposure to strong oxidizing agents

  • Handling Procedures:

    • Avoid vigorous mixing that could denature the protein

    • Minimize freeze-thaw cycles by preparing appropriate aliquots

    • Use low-binding laboratory plasticware to prevent protein adsorption

These stability-enhancing strategies should be empirically optimized for specific experimental applications to ensure GTNG_3319 remains functional throughout complex protocols.

How might GTNG_3319 be used as a model for understanding thermophilic membrane protein adaptations?

GTNG_3319 offers valuable opportunities as a model system for understanding thermophilic adaptations in membrane proteins:

  • Comparative Structural Studies: Compare GTNG_3319 with mesophilic homologs to identify specific structural features contributing to thermostability, including:

    • Differences in membrane-spanning regions

    • Distribution of charged residues at membrane interfaces

    • Specific stabilizing interactions unique to the thermophilic protein

  • Lipid-Protein Interactions: Investigate how GTNG_3319 interacts with lipids at elevated temperatures, potentially revealing specialized lipid binding modes that contribute to thermostability.

  • Thermostability Engineering: Use insights from GTNG_3319 to design thermostable variants of mesophilic membrane transporters, which could have biotechnological applications.

  • Functional Robustness: Study how transport activity is maintained across a broad temperature range, providing insights into thermal adaptation of membrane transport processes.

  • Evolutionary Analysis: Comparative genomics between G. thermodenitrificans and related mesophilic species could reveal evolutionary pathways leading to thermoadaptation of membrane proteins.

This research would contribute to fundamental understanding of protein thermal adaptation while potentially informing the engineering of thermostable proteins for biotechnological applications.

What potential applications exist for engineered variants of GTNG_3319?

Engineered variants of GTNG_3319 could find applications in various research and biotechnological contexts:

  • Manganese Bioremediation:

    • Enhanced-activity variants could be incorporated into bioremediation systems for manganese contamination

    • Thermostable nature allows function in varied environmental conditions

  • Biosensors:

    • Development of manganese-sensitive biosensors based on GTNG_3319 binding properties

    • Potential incorporation into whole-cell biosensors for environmental monitoring

  • Protein Engineering Templates:

    • Thermostable scaffold for engineering novel metal transport specificities

    • Model system for understanding how to engineer stability into other membrane proteins

  • Structural Biology Tools:

    • Thermostable membrane protein for method development in structural biology

    • Potential fusion partner to stabilize other membrane proteins for structural studies

  • Industrial Catalysis:

    • Potential use in high-temperature industrial processes requiring manganese cofactors

    • Integration into enzyme cascades operating at elevated temperatures

These applications would leverage the natural thermostability and metal transport properties of GTNG_3319 while extending its functional repertoire through protein engineering.

How can integrated multi-technique approaches advance understanding of GTNG_3319 function?

A comprehensive understanding of GTNG_3319 requires integration of multiple experimental and computational techniques:

  • Integrated Structural Biology:

    • Combining cryo-EM, X-ray crystallography, and computational modeling

    • Complementing static structures with dynamics information from hydrogen-deuterium exchange mass spectrometry

    • Correlating structural features with functional states

  • Multi-scale Dynamics:

    • Molecular dynamics simulations to predict conformational changes

    • Single-molecule FRET to observe conformational dynamics experimentally

    • Correlating dynamics with transport kinetics

  • Systems Biology Approaches:

    • Transcriptomic analysis to identify co-regulated genes in manganese homeostasis

    • Metabolomic profiling to assess broader impacts of manganese transport

    • Integration with proteomic data on metal-dependent processes

  • In Silico and Experimental Screens:

    • Virtual screening for potential inhibitors or modulators

    • Experimental validation of computational predictions

    • Iterative refinement of computational models based on experimental data

  • Native Environment Analysis:

    • Studying GTNG_3319 directly in G. thermodenitrificans using genetic tools

    • In-cell structural biology approaches like in-cell NMR

    • Correlating molecular function with cellular physiology

This integrated approach would provide a comprehensive understanding of GTNG_3319's role in manganese homeostasis within the context of thermophilic bacterial physiology, potentially revealing principles applicable to other membrane transport systems and informing future protein engineering efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.