Recombinant Geobacillus thermodenitrificans UPF0295 protein GTNG_0491 (GTNG_0491)

Shipped with Ice Packs
In Stock

Description

Protein Sequence and Structure

GTNG_0491 is a full-length protein consisting of 117 amino acids with the sequence: MGIKYSSKINKIRTFALSLIFVGVIVMYLGLFFRTSPIIMTLFMVLGLLFLVASGIVYFWIGTLSTRAVQVVCPSCGKVTKMLGRVDLCMFCREPLTLDRELEGKEFDEKYNKKRKN . This protein is classified as part of the UPF0295 family, indicating its function remains not fully characterized despite structural information being available. The protein has a UniProt ID of A4IKL9, confirming its identification in the Geobacillus thermodenitrificans (strain NG80-2) proteome .

Analysis of the amino acid sequence reveals several notable features. The protein contains a relatively high proportion of hydrophobic residues, suggesting possible membrane association or integration. The presence of cysteine residues (particularly in the sequence motif VCPSCGK) indicates potential for disulfide bond formation, which may be crucial for the protein's structural stability and function.

Comparison with Other GTPases

While not explicitly classified as a GTPase in the provided information, the GTNG_0491 protein shares some sequence similarities with proteins from the GTPase superfamily. Drawing parallels from research on small GTPases, it's worth noting that these proteins typically function as molecular switches, cycling between active (GTP-bound) and inactive (GDP-bound) states . Small GTPases like those found in Arabidopsis thaliana demonstrate specific binding kinetics with nucleotides, which could provide insight into potential functional aspects of GTNG_0491 if it shares similar domains .

For reference, studies on small GTPases have reported distinctive kinetic parameters:

  • Association rate constants (kon) for nucleotide binding

  • Dissociation rate constants (koff) for nucleotide release

  • GTP hydrolysis rates (kcat) determining the protein's cycling between active and inactive states

Expression Hosts

Expression SystemAdvantagesApplications
E. coliHigh yield, cost-effectiveMost common, suitable for basic studies
YeastPost-translational modificationsMore complex structural studies
Mammalian cellsNative-like modificationsFunctional studies requiring complex folding
Insect cellsHigh expression of complex proteinsStructural biology applications

The choice of expression system significantly impacts the protein's folding, post-translational modifications, and ultimately its functional properties. For most basic research applications, E. coli-expressed GTNG_0491 is sufficient and most commonly used .

Fusion Tags and Purification

Recombinant GTNG_0491 is typically expressed with various fusion tags to facilitate purification and detection. Common fusion strategies include:

  • His-tagged (N-terminal) - Most common for affinity purification

  • FLAG-tagged - For immunodetection applications

  • MBP (Maltose Binding Protein) - For enhanced solubility

  • GST (Glutathione S-Transferase) - For alternative purification strategies

  • Other specialized tags: trxA, Nus, Biotin, GFP

The N-terminal His-tagged version is particularly well-documented, allowing efficient purification through metal affinity chromatography. The purified protein typically achieves greater than 90% purity as determined by SDS-PAGE analysis .

Physical Properties

The recombinant GTNG_0491 protein exhibits specific biochemical properties that influence its handling and experimental applications:

PropertySpecificationReference
Molecular Weight~13 kDa (protein only)Calculated from sequence
FormLyophilized powder
Purity>90% (SDS-PAGE)
StabilityStore at -20°C/-80°C

The protein is typically supplied in a lyophilized form, requiring reconstitution before use. The molecular weight may vary depending on the fusion tag used, with His-tagged versions being slightly larger than the native protein.

Commercial providers implement various quality control measures to ensure the purity and functionality of recombinant GTNG_0491:

  1. Purity assessment via SDS-PAGE (typically >80%, >90%, or >95% available)

  2. Protein quantification using spectrophotometric methods or BCA assays

  3. Verification of full-length protein expression

  4. Confirmation of tag presence and functionality

For specialized applications, additional quality control measures may include:

  • Endotoxin removal for cell culture applications

  • Filtration sterilization for biological experiments

  • Mass spectrometry confirmation of protein identity

Comparative Analysis with Related Proteins

Drawing from research on other small bacterial proteins, particularly GTPases, we can identify potential parallels with GTNG_0491. Studies on small GTPases have established methodologies for investigating nucleotide binding and hydrolysis activities using:

  1. Stopped-flow fluorimetry for real-time kinetics monitoring

  2. Fluorescent guanine nucleotides (mdGDP, mGppNHp) as experimental tools

  3. HPLC analysis for GTP hydrolysis rate determination

These experimental approaches could be adapted to investigate the potential GTPase activity of GTNG_0491, if present, though such characterization remains to be reported in the available literature.

Functional Investigation

Understanding the biochemical function of GTNG_0491 remains a significant research opportunity. Potential approaches include:

  1. Nucleotide binding assays to assess potential GTPase activity

  2. Bacterial knockout studies to identify phenotypic changes

  3. Localization studies to determine cellular distribution

  4. Proteomic analysis to identify interaction networks

The UPF0295 protein family represents a group of proteins with conserved sequences but undefined functions, making GTNG_0491 an interesting target for researchers working on protein function discovery.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution. Store aliquots at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us. We will prioritize developing the specified tag if possible.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Target Protein Sequence
MGIKYSSKINKIRTFALSLIFVGVIVMYLGLFFRTSPIIMTLFMVLGLLFLVASGIVYFW IGTLSTRAVQVVCPSCGKVTKMLGRVDLCMFCREPLTLDRELEGKEFDEKYNKKRKN

Q&A

What is the optimal storage condition for Recombinant Geobacillus thermodenitrificans UPF0295 protein GTNG_0491?

The recombinant protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles. The recommended storage buffer is Tris/PBS-based with 6% Trehalose at pH 8.0. For working aliquots, storage at 4°C is suitable for up to one week, but repeated freezing and thawing should be avoided to maintain protein integrity .

When planning long-term storage, it is advisable to add glycerol (final concentration 5-50%, with 50% being the default recommendation) before aliquoting and storing at -20°C/-80°C. This glycerol addition helps prevent protein denaturation during freeze-thaw cycles and maintains protein stability over extended storage periods .

How should Recombinant GTNG_0491 protein be reconstituted for experimental use?

For proper reconstitution of the lyophilized protein:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) for long-term storage

  • Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles

This methodological approach is critical for maintaining protein activity. The reconstitution process should be performed at room temperature unless otherwise specified, with gentle mixing rather than vortexing to prevent protein denaturation. For experiments requiring specific buffers, researchers may need to dialyze the reconstituted protein against their buffer of choice, recognizing that this process might result in some reduction of enzyme activity as observed with other proteins from G. thermodenitrificans .

What control variables are critical when designing experiments with GTNG_0491 protein?

When designing experiments with GTNG_0491 protein, several critical control variables must be considered:

Variable TypeExamplesImportance in Experimental Design
Physical ParametersTemperature, pH, ionic strengthCritical for thermostable proteins from G. thermodenitrificans that function optimally at elevated temperatures
Buffer CompositionSalt concentration, presence of metal ions, reducing agentsMay affect protein stability and activity
Experimental ControlsNegative control (buffer only), positive control (known active protein)Essential for validating experimental results
Time VariablesIncubation time, reaction kinetics measurement intervalsImportant for determining enzyme kinetics and stability over time

Temperature is particularly critical when working with proteins from thermophilic organisms like G. thermodenitrificans. Based on growth data from related research, temperatures of 65°C may be optimal for protein activity, though specific testing for GTNG_0491 would be necessary .

In true experimental design, researchers should implement randomization where possible to distribute any unknown variables across experimental groups. This includes randomizing the order of sample processing and measurement to minimize systematic errors .

How should dependent and independent variables be structured when analyzing GTNG_0491 protein function?

When designing experiments to analyze GTNG_0491 protein function:

Independent Variables (IVs):

  • Protein concentration

  • Substrate concentration (if enzymatic activity is being measured)

  • Temperature conditions

  • pH levels

  • Presence of potential cofactors or inhibitors

Dependent Variables (DVs):

  • Protein activity measurements

  • Binding affinity

  • Structural stability under different conditions

  • Changes in spectroscopic properties

For robust experimental design, researchers should manipulate one independent variable at a time while holding others constant. This allows for clear attribution of observed effects to the manipulated variable. For example, testing temperature effects would involve keeping protein concentration, buffer composition, and other factors constant while varying only temperature .

Multiple replicates should be performed to ensure statistical reliability, with a minimum of three technical replicates per condition and ideally multiple biological replicates if the protein is freshly expressed each time. Statistical analysis should include appropriate tests for significance, such as ANOVA for comparing multiple conditions or t-tests for pairwise comparisons, with clear reporting of p-values and confidence intervals .

What are the methodological considerations for expressing GTNG_0491 protein in E. coli?

The recombinant expression of GTNG_0491 in E. coli requires careful optimization of several parameters:

  • Vector Selection: Choose an expression vector with appropriate promoters (T7, tac) and fusion tags (His-tag as used in the commercial preparation) that facilitate both expression and purification .

  • Host Strain Selection: BL21(DE3) or Rosetta strains are often preferred for proteins with rare codons. The choice depends on factors such as protein toxicity, codon usage, and required post-translational modifications.

  • Expression Conditions:

    • Induction parameters (IPTG concentration, typically 0.1-1.0 mM)

    • Temperature (lower temperatures of 16-25°C may increase soluble protein yield despite the thermophilic origin)

    • Duration of expression (4-24 hours, requiring optimization)

    • Growth media composition (rich media like LB or defined media for specific applications)

  • Solubility Enhancement: For proteins with hydrophobic regions like GTNG_0491, consider:

    • Co-expression with chaperones

    • Addition of solubility-enhancing additives

    • Using fusion partners like MBP or SUMO that enhance solubility

  • Purification Strategy:

    • Immobilized Metal Affinity Chromatography (IMAC) for His-tagged proteins

    • Consider heat treatment as a purification step, leveraging the thermostability of GTNG_0491

    • Subsequent chromatography steps if higher purity is required

When optimizing expression, a factorial experimental design should be implemented, testing combinations of the above variables to identify optimal conditions. For thermostable proteins, exploiting heat treatment (65-75°C) during purification can provide a significant advantage by denaturing most E. coli host proteins while preserving the target thermostable protein .

What analytical techniques are most appropriate for structural characterization of GTNG_0491 protein?

For comprehensive structural characterization of GTNG_0491 protein, several complementary analytical techniques should be employed:

TechniqueApplicationResolutionSample Requirements
Circular Dichroism (CD)Secondary structure analysisLow0.1-0.5 mg/mL, 200-300 μL
Nuclear Magnetic Resonance (NMR)Atomic-level structure determination for smaller proteinsHigh5-10 mg, isotope-labeled
X-ray CrystallographyHigh-resolution 3D structure determinationVery highDiffraction-quality crystals
Differential Scanning Calorimetry (DSC)Thermal stability analysisN/A0.5-1 mg/mL, 300-600 μL
Size Exclusion Chromatography (SEC)Oligomeric state and homogeneity assessmentLow50-100 μg protein
Mass SpectrometryMolecular weight verification, post-translational modificationsVariable1-10 pmol

Given the thermophilic nature of G. thermodenitrificans, thermal stability analysis via DSC or thermal denaturation monitored by CD would be particularly valuable. These techniques can determine the melting temperature (Tm) of the protein, which for thermostable proteins can often exceed 70-80°C.

For membrane or membrane-associated proteins, which GTNG_0491 may be based on its sequence, additional techniques such as lipid-based reconstitution followed by cryo-electron microscopy might be necessary to capture the native structure in a membrane-like environment.

How can researchers assess the thermostability profile of GTNG_0491 protein?

To thoroughly characterize the thermostability profile of GTNG_0491 protein, researchers should employ a multi-method approach:

  • Thermal Inactivation Assays:

    • Incubate protein aliquots at different temperatures (e.g., 50°C, 60°C, 70°C, 80°C, 90°C)

    • At timed intervals, remove samples and measure residual activity

    • Plot inactivation curves and calculate half-life at each temperature

  • Differential Scanning Calorimetry (DSC):

    • Measures heat capacity changes during protein unfolding

    • Provides thermodynamic parameters (ΔH, ΔS, ΔG)

    • Determines the melting temperature (Tm) precisely

  • Circular Dichroism (CD) Thermal Melts:

    • Monitor changes in secondary structure during heating

    • Plot ellipticity at 222 nm versus temperature

    • Calculate the midpoint of the thermal transition

  • Fluorescence-Based Thermal Shift Assays:

    • Use environment-sensitive dyes (SYPRO Orange)

    • Monitor fluorescence changes as the protein unfolds

    • High-throughput method for testing multiple conditions

  • Dynamic Light Scattering (DLS) Temperature Scans:

    • Monitor size distribution changes with increasing temperature

    • Detect aggregation onset temperature

    • Assess colloidal stability at elevated temperatures

The data from these methods should be integrated to provide a comprehensive thermostability profile. Researchers should specifically compare GTNG_0491's thermostability to that of homologous proteins from mesophilic organisms to identify structural features contributing to enhanced thermostability.

Based on studies with other thermostable proteins from G. thermodenitrificans, like the lipase enzyme, which remains active at 65°C, GTNG_0491 would likely display significant thermostability with activity retained at temperatures that would denature most mesophilic proteins .

What methodology should be employed for functional characterization of a protein with unknown function like GTNG_0491?

For proteins with unknown function like GTNG_0491, a systematic approach combining computational predictions with experimental verification is recommended:

  • Computational Analysis:

    • Sequence homology searches against characterized proteins

    • Structural homology modeling based on similar fold proteins

    • Functional domain and motif identification

    • Genomic context analysis (examining neighboring genes)

  • Expression System Optimization:

    • Test multiple expression systems (bacterial, yeast, insect, mammalian)

    • Optimize for obtaining properly folded, active protein

    • Consider co-expression with potential binding partners

  • Binding Partner Identification:

    • Pull-down assays with cell lysates from G. thermodenitrificans

    • Yeast two-hybrid screening

    • Protein microarray analysis

    • Cross-linking followed by mass spectrometry

  • Activity Screening:

    • Test for common enzymatic activities (hydrolase, transferase, etc.)

    • Screen against substrate libraries

    • Examine activity under various conditions (temperature, pH, salt)

  • Structural Studies:

    • Determine 3D structure via X-ray crystallography or NMR

    • Identify potential active sites or binding pockets

    • Perform in silico docking studies with potential substrates

  • In vivo Function Assessment:

    • Gene knockout/knockdown in G. thermodenitrificans

    • Complementation studies

    • Phenotypic characterization of mutants

The UPF0295 designation indicates an uncharacterized protein family, suggesting that GTNG_0491's function remains to be definitively determined. The protein's sequence suggests possible membrane association, which should inform experimental approaches. Thermophilic growth conditions (65°C) similar to those used for G. thermodenitrificans lipase production would be appropriate for functional assays .

What is the optimal multi-step purification strategy for obtaining highly pure GTNG_0491 protein for structural studies?

For structural studies requiring highly pure protein, a multi-step purification strategy is essential:

  • Initial Capture:

    • Immobilized Metal Affinity Chromatography (IMAC) utilizing the His-tag

    • Use Ni-NTA or Co-NTA resins with imidazole gradient elution

    • Include low imidazole (10-20 mM) in binding buffer to reduce non-specific binding

  • Intermediate Purification:

    • Ion Exchange Chromatography (IEX) based on the protein's theoretical pI

    • Size Exclusion Chromatography (SEC) to separate oligomeric states and remove aggregates

  • Polishing:

    • Hydrophobic Interaction Chromatography (HIC) if the protein has exposed hydrophobic regions

    • Second pass SEC with analytical-grade column for final purity assessment

  • Quality Control:

    • SDS-PAGE with silver staining (>95% purity required)

    • Western blot for identity confirmation

    • Mass spectrometry for accurate mass determination

    • Dynamic Light Scattering for homogeneity assessment

The purification protocol should be optimized to maintain protein stability at each step. For thermostable proteins like GTNG_0491, a heat treatment step (65-75°C for 10-30 minutes) can be included after the initial lysate clarification to precipitate many E. coli host proteins while preserving the thermostable target protein.

Techniques similar to those used for purifying G. thermodenitrificans lipase might be applicable, where a four-step purification procedure including acetone precipitation, dialysis, and column chromatography achieved significant purification (22.1-fold) .

How should researchers determine the oligomeric state of GTNG_0491 protein in solution?

Determining the oligomeric state of GTNG_0491 in solution requires multiple complementary techniques:

TechniqueInformation ProvidedAdvantagesLimitations
Size Exclusion Chromatography (SEC)Approximate molecular weight based on elution volumeSimple, non-destructiveLimited resolution, shape dependence
SEC-MALS (Multi-Angle Light Scattering)Absolute molecular weight independent of shapeHigh accuracy, detects heterogeneitySpecialized equipment required
Analytical Ultracentrifugation (AUC)Sedimentation coefficient, molecular weightFirst-principles method, no calibration neededTime-consuming, requires specialized equipment
Native Mass SpectrometryPrecise mass of intact complexesExtremely accurate mass determinationMay disrupt weak interactions
Chemical CrosslinkingCaptures transient interactionsCan "freeze" dynamic complexesMay introduce artifacts
SAXS (Small Angle X-ray Scattering)Low-resolution envelope, radius of gyrationWorks in solution, shape informationLimited resolution

For membrane proteins or proteins with highly hydrophobic regions (which GTNG_0491 appears to have based on its sequence), detergent selection is critical. Different detergents should be screened to identify those that maintain the native oligomeric state while effectively solubilizing the protein.

Additionally, researchers should test whether the oligomeric state is temperature-dependent, given the thermophilic nature of the source organism. Comparative analysis at room temperature versus elevated temperatures (e.g., 65°C) would provide valuable insights into structural changes that might occur at the protein's physiological temperature.

What are the methodological considerations for determining if GTNG_0491 interacts with membrane lipids?

To investigate potential GTNG_0491-membrane interactions:

  • Biophysical Approaches:

    • Liposome Binding Assays: Prepare liposomes with varying lipid compositions and assess protein binding through co-sedimentation or flotation assays

    • Surface Plasmon Resonance (SPR): Immobilize lipids on sensor chips and measure binding kinetics

    • Monolayer Insertion Assays: Measure changes in surface pressure upon protein addition to lipid monolayers

  • Structural Approaches:

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Identify protein regions protected from exchange upon lipid binding

    • Electron Paramagnetic Resonance (EPR) with site-directed spin labeling: Determine depth of insertion and orientation in membranes

    • Cryo-Electron Microscopy: Visualize protein-lipid complexes

  • Functional Approaches:

    • Reconstitution into proteoliposomes and functional assays

    • Effects of lipid composition on protein stability and activity

    • Competition assays with lipid-binding domains of known function

  • Computational Approaches:

    • Molecular dynamics simulations of protein-membrane interactions

    • Prediction of membrane-binding regions using algorithms like HeliQuest

The hydrophobic nature of GTNG_0491's amino acid sequence suggests potential membrane association. When designing experiments, researchers should consider the unique lipid composition of thermophilic bacteria, which often contain more saturated fatty acids and specialized lipids that maintain membrane fluidity at high temperatures. Testing interactions with lipid compositions mimicking G. thermodenitrificans membranes would provide the most physiologically relevant results.

How might researchers design experiments to elucidate the physiological role of GTNG_0491 in G. thermodenitrificans?

To determine the physiological role of GTNG_0491:

  • Gene Expression Analysis:

    • RT-qPCR to quantify GTNG_0491 expression under various conditions

    • RNA-Seq to identify co-regulated genes

    • Promoter analysis to identify regulatory elements

  • Genetic Manipulation:

    • Gene knockout or knockdown using CRISPR-Cas9 or antisense RNA

    • Overexpression studies

    • Complementation analysis to confirm phenotypes

    • Site-directed mutagenesis of conserved residues

  • Phenotypic Characterization:

    • Growth curves under various conditions (temperature, pH, nutrients)

    • Stress response assessment (heat shock, oxidative stress, nutrient limitation)

    • Membrane integrity and composition analysis

    • Metabolic profiling using metabolomics

  • Protein Localization:

    • Fluorescent protein fusions to track subcellular localization

    • Immunogold electron microscopy for precise localization

    • Cell fractionation followed by Western blotting

  • Interactome Analysis:

    • Co-immunoprecipitation followed by mass spectrometry

    • Bacterial two-hybrid screening

    • Proximity labeling approaches (BioID, APEX)

When designing these experiments, researchers should consider the unique growth conditions of G. thermodenitrificans, including its optimal temperature (65°C) and pH (6.8), as observed in lipase production studies . Control experiments should include well-characterized proteins from the same organism to establish baseline responses.

What experimental design is most appropriate for comparing the thermostability mechanisms of GTNG_0491 with homologous proteins from mesophilic organisms?

To investigate thermostability mechanisms through comparative analysis:

  • Homolog Selection Strategy:

    • Identify homologs with varying thermostability profiles (psychrophilic, mesophilic, thermophilic)

    • Ensure sufficient sequence similarity for meaningful comparison

    • Select proteins with known structures when possible

  • Experimental Variables to Measure:

    • Thermal inactivation kinetics

    • Unfolding temperatures (Tm)

    • Stability against denaturants (urea, guanidinium HCl)

    • Protease resistance

    • Half-life at elevated temperatures

  • Structural Analysis:

    • Compare crystal structures or homology models

    • Analyze differences in:

      • Ionic interactions

      • Hydrogen bonding networks

      • Hydrophobic core packing

      • Disulfide bond distribution

      • Surface charge distribution

  • Chimeric Protein Design:

    • Create domain-swapped chimeras between thermostable and mesostable homologs

    • Test which regions confer thermostability

  • Mutagenesis Studies:

    • Introduce stabilizing mutations from GTNG_0491 into mesophilic homologs

    • Introduce destabilizing mutations into GTNG_0491

    • Measure effects on thermostability

The experimental design should include multiple replicates and appropriate statistical analysis to identify significant differences. Controls should include well-characterized thermostable and mesostable proteins to validate experimental methods. This comparative approach can reveal evolutionary adaptations that contribute to thermostability in GTNG_0491, providing insights applicable to protein engineering for enhanced thermostability.

How can researchers evaluate potential applications of GTNG_0491 in biotechnology if the function becomes known?

Once the function of GTNG_0491 is determined, evaluating its biotechnological potential requires:

  • Application Screening Framework:

    • Identify industries where thermostable proteins have advantages (biofuels, detergents, food processing)

    • Determine relevant performance metrics for each application

    • Develop high-throughput screening assays specific to potential applications

  • Performance Characterization:

    • Activity in the presence of organic solvents, detergents, and other industrial reagents

    • Long-term stability under application-relevant conditions

    • Compatibility with immobilization techniques for reuse

    • Activity on industrial substrates or in industrial processes

  • Comparative Benchmarking:

    • Side-by-side comparison with currently used industrial enzymes

    • Cost-benefit analysis including production efficiency and performance

    • Evaluation of unique selling points (USPs) compared to competitors

  • Protein Engineering for Application Optimization:

    • Directed evolution for specific applications

    • Rational design based on structure-function understanding

    • Immobilization strategies to enhance stability and reusability

  • Scale-Up Considerations:

    • Laboratory to pilot scale production assessment

    • Process optimization for cost-effective production

    • Quality control parameters and consistency evaluation

Based on knowledge of other thermostable proteins from G. thermodenitrificans, potential applications might include processes requiring stability at elevated temperatures (65°C or higher) and in harsh conditions. If GTNG_0491 has enzymatic activity, its thermostability could make it valuable in industrial bioprocesses where high temperatures are used to increase reaction rates or prevent microbial contamination .

What strategies can address low expression yields of GTNG_0491 in heterologous systems?

When facing low expression yields of GTNG_0491:

  • Expression System Optimization:

    • Test multiple E. coli strains (BL21(DE3), Rosetta, Arctic Express)

    • Try alternative expression hosts (Bacillus, Pichia pastoris)

    • Optimize codon usage for the expression host

    • Use stronger or inducible promoters

  • Protein Solubility Enhancement:

    • Fusion with solubility tags (MBP, SUMO, TrxA)

    • Co-expression with molecular chaperones (GroEL/ES, DnaK/J)

    • Addition of solubilizing agents (sorbitol, arginine)

    • Lower induction temperature (16-20°C)

  • Induction Protocol Refinement:

    • Test various inducer concentrations

    • Optimize cell density at induction (OD600 0.4-0.8)

    • Vary induction duration (4-24 hours)

    • Use auto-induction media

  • Cell Lysis Optimization:

    • Test different lysis methods (sonication, pressure homogenization)

    • Optimize lysis buffer composition

    • Include protective additives (glycerol, reducing agents)

    • Add protease inhibitors to prevent degradation

  • Construct Redesign:

    • Remove potential regulatory elements in the coding sequence

    • Create truncated variants if full-length protein is toxic

    • Test expression with and without signal sequences

    • Optimize ribosome binding site

A factorial experimental design approach is recommended to systematically test combinations of these variables. For proteins from thermophilic organisms like G. thermodenitrificans, expressing at higher temperatures than typically used for E. coli (28-30°C instead of 16-25°C) might improve folding of thermostable proteins while still being compatible with host growth .

What analytical approaches can resolve protein aggregation issues with purified GTNG_0491?

To address aggregation of purified GTNG_0491:

  • Aggregation Detection and Characterization:

    • Dynamic Light Scattering to measure particle size distribution

    • Size Exclusion Chromatography to quantify aggregate percentage

    • Analytical Ultracentrifugation to determine sedimentation profiles

    • Thioflavin T or Congo Red binding to detect amyloid-like aggregates

  • Buffer Optimization Strategy:

    • Systematic pH screening (pH 5-9 in 0.5 unit increments)

    • Ionic strength variation (0-500 mM NaCl)

    • Addition of stabilizing agents:

      • Osmolytes (glycerol, sucrose, trehalose)

      • Amino acids (arginine, proline)

      • Detergents for hydrophobic proteins (0.01-0.1% non-ionic detergents)

      • Reducing agents if disulfide bond formation is an issue

  • Physical Parameter Adjustment:

    • Temperature effects on aggregation kinetics

    • Protein concentration dependence

    • Effects of freezing/thawing cycles

    • Agitation and surface interaction effects

  • Chemical Modification Approaches:

    • PEGylation to increase solubility

    • Surface charge modification

    • Cross-linking stabilization

    • Disulfide engineering

  • Refolding Strategies:

    • On-column refolding during purification

    • Dilution refolding with optimized buffer conditions

    • Dialysis-based gradual denaturant removal

    • Chaperone-assisted refolding

For thermostable proteins like GTNG_0491, consider that the protein may actually be more stable and less prone to aggregation at elevated temperatures that mimic its native environment. Testing stability at 60-65°C compared to room temperature might reveal unexpected improvements in solubility at higher temperatures .

How can researchers troubleshoot inconsistent results in functional assays with GTNG_0491?

When encountering inconsistent functional assay results:

  • Systematic Variable Control:

    • Create a detailed standard operating procedure (SOP)

    • Control temperature precisely (±0.5°C)

    • Prepare fresh reagents at consistent concentrations

    • Use the same lot numbers for critical reagents

    • Standardize protein concentration determination methods

  • Protein Quality Assessment:

    • Verify protein purity by SDS-PAGE before each assay

    • Check for batch-to-batch variation using activity standards

    • Assess protein stability over time during the assay

    • Determine if freeze-thaw cycles affect activity

  • Assay Validation and Controls:

    • Include positive and negative controls in each experiment

    • Implement internal standards for normalization

    • Verify assay linearity and dynamic range

    • Determine assay precision (intra- and inter-assay CV%)

  • Equipment and Handling Verification:

    • Calibrate instruments regularly

    • Validate pipette accuracy

    • Control for positional effects in plate-based assays

    • Standardize mixing methods and timing

  • Data Analysis Refinement:

    • Apply appropriate statistical tests

    • Identify and manage outliers systematically

    • Use technical replicates to assess precision

    • Implement biological replicates to assess variability

For thermophilic proteins like those from G. thermodenitrificans, temperature control is particularly critical. Even small temperature fluctuations can significantly affect activity and stability. Consider using water bath incubation rather than air incubators for more precise temperature control during critical steps .

Implement a systematic troubleshooting approach by changing one variable at a time and documenting all experimental conditions meticulously. This methodical approach will help identify the source of variability and lead to more consistent results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.