Recombinant Geobacillus thermodenitrificans UPF0316 protein GTNG_0803 (GTNG_0803)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
GTNG_0803; UPF0316 protein GTNG_0803
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Geobacillus thermodenitrificans (strain NG80-2)
Target Names
GTNG_0803
Target Protein Sequence
MLKDIVLVLALQLVYVPILTLRTIFMVKNMSLLAAFMGFLEALIYVFGLSIVFSGKQSYI VMIVYAAGFGARGFLLEDISSKSWAIGYTTVTVNLQQKNQELIHLLRESGYGVTVYTGEG RDSQRYRLDILTKRNREEELLELIERYEPKAFIISYEPRRFKGGFLVASMKKRVKRKKEC HES
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should recombinant GTNG_0803 be stored and reconstituted for optimal stability?

For optimal stability, GTNG_0803 should be stored following specific protocols to maintain its structural integrity and biological activity. Upon receipt, the lyophilized protein should be stored at -20°C/-80°C, with aliquoting necessary for multiple use scenarios. The protein is supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during freeze-thaw cycles .

For reconstitution:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation)

  • Aliquot for long-term storage at -20°C/-80°C

Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week . This storage protocol ensures that the protein maintains its structural and functional properties for experimental use.

How can Taguchi Design of Experiments be applied to optimize GTNG_0803 expression?

The Taguchi Design of Experiments (DOE) offers a statistically robust framework for optimizing GTNG_0803 expression while minimizing the number of experimental runs required. For protein expression optimization, a P3 L2 design (three parameters, two levels each) can be particularly useful3.

To implement this approach:

  • Identify key parameters affecting GTNG_0803 expression, such as:

    • Temperature (e.g., 30°C vs. 37°C)

    • IPTG concentration (e.g., 0.5mM vs. 1.0mM)

    • Expression time (e.g., 4h vs. overnight)

  • Create a Taguchi design array to determine the minimum experimental combinations:

ExperimentTemperatureIPTG ConcentrationExpression Time
1Level 1Level 1Level 1
2Level 1Level 2Level 2
3Level 2Level 1Level 2
4Level 2Level 2Level 1
  • Run the experiments and measure the yield of correctly folded GTNG_0803 protein

  • Calculate the average effect of each parameter level using the formula:

    • Average for Parameter A Level 1 = (Result from Exp1 + Result from Exp2)/2

    • Average for Parameter B Level 1 = (Result from Exp1 + Result from Exp3)/23

  • Determine the optimal combination based on these calculations

This approach significantly reduces the experimental burden compared to full factorial designs (which would require 2³=8 experiments) while still providing statistically reliable results for optimizing GTNG_0803 expression conditions3.

What methodological approaches should be used when contradictory results arise in GTNG_0803 functional studies?

When contradictory results occur in GTNG_0803 functional studies, researchers should adopt a systematic approach rather than dismissing inconsistencies. As noted by Alfred North Whitehead, "In formal logic, a contradiction is the signal of defeat, but in the evolution of real knowledge, it marks the first step in progress toward a victory" .

Methodological approaches to address contradictions include:

  • Examine confirmation bias: Be aware that researchers expecting a positive correlation between variables are more than twice as likely to report detecting one than those expecting a negative correlation, even when examining identical data . Implement blinded analysis protocols for objective assessment.

  • Implement "night science" exploratory mode: This counteracts cognitive biases and opens the door to new insights and predictions. While conducting structured "day science" experiments, allow time for exploratory "night science" to generate hypotheses about why contradictions might be occurring .

  • Design validation experiments: Create specific experiments that directly test competing hypotheses arising from contradictory results.

  • Analyze experimental limitations: Document all experimental conditions meticulously, including:

    • Protein batch variations

    • Buffer composition differences

    • Equipment calibration status

    • Sample handling protocols

  • Employ orthogonal methods: Validate findings using multiple techniques to ensure results aren't artifacts of a particular methodology5.

This systematic approach transforms contradictions from research obstacles into opportunities for deeper understanding of GTNG_0803 function and potentially novel scientific discoveries .

How should a comprehensive research methodology for GTNG_0803 structural characterization be designed?

A comprehensive research methodology for GTNG_0803 structural characterization requires integration of multiple analytical techniques. When designing this methodology, consider the distinction between methods (data collection techniques) and methodology (the overarching strategy and reasoning)5.

The research methodology should include three critical components:

  • Data Collection Strategy:

    • Primary structure verification through mass spectrometry

    • Secondary structure analysis using circular dichroism

    • Tertiary structure determination via X-ray crystallography or NMR

    • Quaternary structure evaluation through analytical ultracentrifugation

    • Thermostability assessment appropriate for a thermophilic protein

  • Data Analysis Framework:

    • Statistical analysis parameters for each technique

    • Software packages for structural modeling and visualization

    • Comparative analysis with homologous proteins

    • Integration of multiple datasets to generate a comprehensive structural model

  • Methodological Limitations Assessment:

    • Resolution limitations of structural techniques

    • Sample preparation constraints

    • Potential artifacts introduced by the His-tag

    • Differences between recombinant and native protein structures5

This three-component approach ensures that the structural characterization is systematic, rigorous, and accounts for the unique challenges presented by GTNG_0803 as a thermophilic bacterial protein. The design should clearly link back to specific research questions about the protein's structure-function relationship5.

What are the optimal experimental conditions for assessing the thermostability of GTNG_0803?

Given that GTNG_0803 originates from Geobacillus thermodenitrificans, a thermophilic bacterium, determining its thermostability characteristics requires specialized experimental conditions. The optimal approach combines multiple analytical techniques under carefully controlled temperature regimes.

The following experimental conditions are recommended:

  • Differential Scanning Calorimetry (DSC):

    • Temperature range: 25°C to 110°C (to accommodate thermophilic properties)

    • Heating rate: 1°C/min for precise transition detection

    • Protein concentration: 0.5-2.0 mg/mL in storage buffer

    • Reference: Same buffer without protein

    • Data collection: Heat capacity vs. temperature5

  • Thermogravimetric Analysis (TGA):

    • Temperature range: 25°C to 120°C

    • Heating rate: 5°C/min

    • Sample preparation: Lyophilized protein sample (5-10 mg)

    • Atmosphere: Nitrogen to prevent oxidation

    • Data collection: Weight loss vs. temperature5

  • Circular Dichroism with Temperature Ramping:

    • Temperature range: 25°C to 100°C with 5°C increments

    • Wavelength scan: 190-260 nm

    • Protein concentration: 0.1-0.2 mg/mL

    • Data analysis: Changes in secondary structure elements with temperature

  • Activity Assays at Various Temperatures:

    • Temperature points: 30°C, 45°C, 60°C, 75°C, 90°C

    • Pre-incubation times: 0, 30, 60, 120 minutes

    • Controls: Well-characterized thermostable and mesophilic proteins

A Taguchi experimental design could optimize these conditions while reducing the number of experiments required, particularly for the activity assays at multiple temperature/time combinations3.

How should contradictory data regarding GTNG_0803 function be analyzed and reconciled?

When faced with contradictory data regarding GTNG_0803 function, researchers should implement a structured approach to data analysis and reconciliation rather than simply discarding outliers or selecting preferred results.

The analysis methodology should include:

  • Comprehensive Data Visualization:

    • Plot all data points, including those that appear contradictory

    • Look for superposition of multiple trends, as contradictory data may reveal multiple underlying phenomena

    • Use visualization techniques that can reveal patterns not immediately obvious in numerical analysis

  • Controlled Bias Examination:

    • Document pre-existing hypotheses and expectations before data interpretation

    • Implement blinded analysis when possible

    • Have multiple researchers independently analyze the same dataset to identify interpretational biases

  • Statistical Reconciliation Approaches:

    • Perform cluster analysis to determine if contradictory results form distinct groups

    • Apply Bayesian analysis to integrate prior knowledge with new observations

    • Consider using meta-analysis techniques if multiple experiments produced contradictory results

  • Experimental Design Revision:

    • Design targeted experiments to specifically address the contradiction

    • Vary experimental conditions systematically to determine if the contradiction is condition-dependent

    • Create a Taguchi design array to efficiently explore potential factors causing the discrepancy3

  • Theoretical Framework Examination:

    • Revisit the theoretical basis for expected results

    • Consider if contradictions might suggest novel functions or properties of GTNG_0803

    • Develop new hypotheses that could potentially explain all observations

This systematic approach transforms contradictions from frustrating outliers into valuable scientific opportunities, potentially leading to novel insights about GTNG_0803 function .

What statistical approaches are most appropriate for analyzing GTNG_0803 functional assay data?

The statistical analysis of GTNG_0803 functional assay data requires approaches that account for potential experimental variability while providing robust insights into protein function. The following statistical methodology is recommended for comprehensive data analysis:

When implementing these approaches, researchers should clearly document all statistical assumptions, transformations, and software packages used to ensure reproducibility. For thermostable proteins like GTNG_0803, special attention should be paid to temperature effects in the statistical models, potentially incorporating temperature as a covariate in analyses5.

How can recombinant GTNG_0803 be utilized in methodological studies of protein thermostability?

Recombinant GTNG_0803, as a protein derived from the thermophilic bacterium Geobacillus thermodenitrificans, offers unique opportunities for methodological studies of protein thermostability. Its application in such studies can follow several structured approaches:

  • Comparative Stability Analysis Methodology:

    • Construct a panel of recombinant proteins including GTNG_0803 and mesophilic homologs

    • Implement parallel stability assays across temperature gradients (30-100°C)

    • Analyze unfolding kinetics using real-time monitoring techniques

    • Quantify the energetics of stabilization using microcalorimetry

    • Correlate amino acid composition with thermal stability parameters

  • Structure-Guided Mutagenesis Protocol:

    • Identify conserved residues in GTNG_0803 compared to mesophilic homologs

    • Design systematic mutations targeting key structural elements

    • Express mutant variants using the optimized protocol developed through Taguchi DOE3

    • Assess thermostability changes using differential scanning calorimetry5

    • Correlate structural modifications with stability alterations

  • Molecular Dynamics Simulation Framework:

    • Create detailed atomistic models of GTNG_0803 based on sequence data

    • Perform simulations at various temperatures (25-100°C)

    • Analyze fluctuation patterns and structural rigidity

    • Identify key intramolecular interactions contributing to thermostability

    • Validate computational predictions through targeted mutagenesis

  • Industrial Application Methodology Development:

    • Assess GTNG_0803 stability in various buffer systems and pH conditions

    • Evaluate compatibility with common solvents and additives

    • Develop immobilization protocols for thermostable biocatalysis applications

    • Measure long-term activity retention at elevated temperatures

These methodological approaches not only advance our understanding of GTNG_0803 specifically but also contribute to broader principles of protein engineering for enhanced thermostability in biotechnological applications.

What are the key methodological considerations when designing experiments to explore the potential cellular function of GTNG_0803?

When designing experiments to elucidate the cellular function of GTNG_0803, researchers must consider several methodological aspects specific to this thermophilic bacterial protein. The experimental design should integrate multiple approaches to build a comprehensive understanding of function.

Key methodological considerations include:

  • Phylogenetic Analysis Framework:

    • Construct comprehensive phylogenetic trees of UPF0316 family proteins

    • Identify conserved domains and motifs across thermophilic and mesophilic organisms

    • Analyze genomic context and gene neighborhood in Geobacillus thermodenitrificans

    • Map evolutionary relationships to generate functional hypotheses

    • Correlate sequence conservation patterns with predicted structural elements

  • Expression Profiling Methodology:

    • Design primers for quantitative RT-PCR of GTNG_0803 in native organism

    • Establish growth conditions mimicking natural thermophilic environments

    • Monitor expression under various stress conditions (temperature shifts, nutrient limitation)

    • Correlate expression patterns with other genes of known function

    • Implement RNA-seq for genome-wide contextual analysis

  • Protein-Protein Interaction Study Design:

    • Develop pull-down assays using His-tagged GTNG_0803

    • Optimize crosslinking protocols for thermophilic reaction conditions

    • Implement bacterial two-hybrid systems adapted for thermophilic proteins

    • Perform co-immunoprecipitation with antibodies raised against recombinant GTNG_0803

    • Validate interactions through reciprocal tagging approaches

  • Knockout/Complementation Strategy:

    • Design targeted gene deletion constructs for GTNG_0803

    • Develop transformation protocols for Geobacillus thermodenitrificans

    • Create complementation vectors with wild-type and mutant variants

    • Establish phenotypic assays relevant to thermophilic bacteria

    • Implement Taguchi design for efficient phenotypic screening3

  • Localization Study Methodology:

    • Generate fluorescent protein fusions optimized for thermophilic conditions

    • Establish imaging protocols for thermophilic bacteria

    • Perform subcellular fractionation with immunoblotting

    • Correlate localization patterns with predicted protein characteristics

    • Map temporal changes in localization during growth and stress response

By systematically addressing these methodological considerations, researchers can develop a robust experimental framework that overcomes the challenges associated with studying proteins from thermophilic organisms while generating meaningful insights into GTNG_0803's cellular function.

What are the most common methodological pitfalls when working with recombinant thermophilic proteins like GTNG_0803?

Working with recombinant thermophilic proteins such as GTNG_0803 presents unique methodological challenges that can affect experimental outcomes. Being aware of these common pitfalls allows researchers to design more robust studies and interpret results more accurately.

The most significant methodological challenges include:

  • Expression System Limitations:

    • E. coli expression systems may lack appropriate chaperones for thermophilic protein folding

    • Expression at lower temperatures may lead to misfolding of proteins evolved for thermophilic environments

    • Codon usage optimization is often overlooked but critical for efficient expression

    • His-tags may interfere with structural elements critical for thermostability

  • Buffer Formulation Errors:

    • Using standard buffers without considering temperature effects on pH (pH drift)

    • Failing to account for different salt requirements at elevated temperatures

    • Overlooking the importance of stabilizing agents like trehalose in storage buffers

    • Using reducing agents that become unstable at higher temperatures

  • Analytical Method Misapplication:

    • Applying standard temperature ranges in thermal shift assays that fail to capture the elevated melting points

    • Using inappropriate reference proteins in comparative studies

    • Failing to distinguish between reversible and irreversible thermal unfolding

    • Overlooking the impact of concentration-dependent effects in stability studies

  • Experimental Design Inefficiencies:

    • Conducting full factorial experiments when Taguchi designs would be more efficient3

    • Failing to account for interaction effects between parameters

    • Overlooking the importance of technical replicates for thermostability assessments

    • Not validating findings across multiple batches of recombinant protein

  • Data Interpretation Challenges:

    • Confirmation bias when analyzing contradictory results

    • Inappropriate extrapolation of findings from standard conditions to thermophilic environments

    • Overlooking the distinction between protein stability and activity

    • Failing to consider the natural cellular environment of the thermophilic source organism

By addressing these methodological pitfalls proactively, researchers can enhance the reliability and reproducibility of studies involving GTNG_0803 and other thermophilic proteins, ultimately leading to more meaningful scientific contributions in this specialized field.

How should researchers approach the integration of computational and experimental methods when studying GTNG_0803?

The integration of computational and experimental approaches creates a powerful methodology for studying GTNG_0803 that can yield insights beyond what either approach could achieve independently. This integration should follow a structured cyclical framework that allows each method to inform and validate the other.

A comprehensive methodology for integrating these approaches includes:

  • Sequential Model-Experiment-Refine Cycle:

    • Begin with sequence-based predictions of GTNG_0803 structure using the known amino acid sequence

    • Generate testable hypotheses about structure-function relationships

    • Design targeted experiments to validate computational predictions

    • Refine computational models based on experimental data

    • Develop new predictions from refined models to guide subsequent experiments

  • Parallel Investigation Tracks with Integration Points:

    • Conduct molecular dynamics simulations of thermostability parallel to DSC experiments

    • Perform in silico docking studies alongside experimental binding assays

    • Compare predicted evolutionary conservation patterns with experimental mutational analysis

    • Integrate findings at predetermined analysis points to identify convergent insights

    • Address contradictions between computational and experimental results systematically

  • Data Integration Framework:

    • Develop standardized formats for computational and experimental data

    • Implement statistical methods specifically designed for integrating heterogeneous data types

    • Use Bayesian approaches to update computational models with experimental probabilities

    • Apply machine learning to identify patterns across computational and experimental datasets

    • Create visualization tools that effectively represent both data types simultaneously

  • Methodological Validation Strategy:

    • Design critical experiments that can definitively validate or refute computational predictions

    • Use Taguchi experimental design to efficiently test computational hypotheses3

    • Implement sensitivity analysis to determine how computational parameter changes affect agreement with experiments

    • Establish quantitative metrics for assessing the concordance between computational and experimental results

    • Document areas of persistent disagreement as opportunities for methodological improvement

  • Resource Optimization Framework:

    • Use computational approaches to prioritize experimental directions

    • Reserve resource-intensive experiments for validating high-confidence computational predictions

    • Apply value-of-information analysis to determine when additional experiments or computations are warranted

    • Balance resource allocation between computational and experimental approaches based on progressive findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.