Recombinant Geobacter bemidjiensis ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Geobacter bemidjiensis ATP Synthase Subunit a (atpB)

Recombinant Geobacter bemidjiensis ATP synthase subunit a (atpB) is a full-length protein (1–229 amino acids) fused to an N-terminal His tag for purification. It is expressed in Escherichia coli and corresponds to UniProt ID B5EFG8 . This subunit plays a pivotal role in proton translocation across the membrane during ATP synthesis, a process critical for energy generation in Geobacter species under iron-reducing conditions .

Functional Role in Geobacter Metabolism

ATP synthase subunit a is integral to the F₀ sector of the ATP synthase complex, facilitating proton transport across the membrane to drive ATP synthesis. In Geobacter bemidjiensis, this enzyme is highly expressed during periods of high metabolic demand, such as Fe(III) reduction or aromatic compound degradation . Proteomic studies of subsurface Geobacter-dominated communities revealed that ATP synthase subunits are abundant during rapid growth phases, underscoring their role in energy conservation under biostimulated conditions .

Key Functional Insights:

  • Energy Demand: ATP synthase activity correlates with metabolic rates, as shown by elevated citrate synthase levels (a TCA cycle marker) during acetate metabolism .

  • Bioremediation Relevance: Geobacter species rely on ATP synthase for energy during uranium and petroleum hydrocarbon degradation, making recombinant atpB valuable for studying these processes .

Metabolic Engineering

Engineered Geobacter sulfurreducens strains with modified ATP synthase activity exhibit altered respiration rates. For example, inducing ATP hydrolysis via the F₁ subunit increased respiration but reduced cell yield, highlighting the trade-off between energy production and growth . These findings suggest that recombinant atpB could be used to optimize electron transfer in bioelectrochemical systems.

Production and Purification

The protein is produced in E. coli using codon-optimized sequences and purified via immobilized metal affinity chromatography (IMAC) leveraging the His tag . Reconstitution recommendations include dissolving lyophilized powder in sterile water with glycerol (5–50%) for long-term storage at -80°C .

Future Directions

Further research could explore:

  • Cryo-EM Studies: Resolving the structure of the Geobacter ATP synthase complex.

  • Biotechnological Optimization: Leveraging recombinant atpB to enhance microbial fuel cell efficiency or metal remediation rates .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpB; Gbem_3931; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622)
Target Names
atpB
Target Protein Sequence
MVHPYLFLNFFRELLHPLGFSEAGADAVVYTWLIMIGLVVLSIAATKRLQAVPSGLQNFM EVIVGGIENMLVETMGEHGKPFFPLVATLALFILVSNLIGLVPGFFPPTANINTTAACAV VVFVTTHIVGVKHHGAGYIKHFLGPIAWLAPMMFFIEVIGHLSRVISLTLRLFGNMNGHE LVLIIFFGLAPFIVPLPMMLMGVLVSFIQAFVFMLLAMIYIQGSLEHAH
Uniprot No.

Target Background

Function

Function: A key component of the proton channel, directly involved in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional role of ATP synthase subunit a (atpB) in Geobacter bemidjiensis?

ATP synthase subunit a (atpB) is a critical component of the F0 sector of ATP synthase located in the inner bacterial membrane of Geobacter bemidjiensis. This subunit works in conjunction with other ATP synthase components to facilitate ATP generation through proton translocation across the membrane. The protein consists of 229 amino acids (full-length) and contains transmembrane regions that form part of the proton channel .

Functionally, atpB is essential for maintaining the proton motive force required for ATP synthesis. Mutations in atpB have been shown to significantly impair ATP generation and release, as demonstrated in studies using genetic mutant strains . The protein's structural integrity is necessary for proper ATP synthase assembly and function, directly affecting bacterial growth and survival.

How does ATP synthase in Geobacter bemidjiensis compare to other bacterial ATP synthases?

While the fundamental mechanism of ATP synthesis is conserved across bacterial species, several key differences exist between G. bemidjiensis ATP synthase and other bacterial homologs:

FeatureGeobacter bemidjiensisOther Bacterial Species (e.g., E. coli, Bacillus PS3)
StructureContains atpB (subunit a) with 229 amino acidsSimilar subunit organization but with species-specific sequence variations
FunctionSpecialized for anaerobic environments; involved in Fe(III) reductionAdapted to respective ecological niches
RegulationLikely regulated in response to environmental conditions and energy needsSpecies-specific regulatory mechanisms (e.g., inhibition by subunit ε in Bacillus PS3)
ExpressionMay be coordinated with other energy metabolism genesOften regulated as part of an operon system

Bacterial ATP synthases generally share the core F0-F1 architecture but differ in specific amino acid sequences and regulatory mechanisms. The Bacillus PS3 ATP synthase, for example, has been more extensively studied structurally, revealing how its subunit ε can inhibit ATP hydrolysis while allowing ATP synthesis . Studies with G. bemidjiensis ATP synthase would likely reveal adaptations specific to its anaerobic, metal-reducing lifestyle .

What are the optimal expression systems for producing recombinant G. bemidjiensis atpB protein?

For successful expression of recombinant G. bemidjiensis atpB, several expression systems have been validated with varying advantages:

Expression SystemAdvantagesConsiderationsRecommended For
E. coliHigh yield, cost-effective, well-established protocolsMay require optimization for membrane protein expressionInitial characterization studies, mutational analyses
YeastBetter for complex folding, post-translational modificationsLower yields than E. coliFunctional studies requiring native folding
BaculovirusGood for large proteins, maintains functionalityHigher cost, technically demandingStructural studies requiring native conformation
Mammalian cellsExcellent for preserving native structureLowest yield, highest costInteraction studies with eukaryotic partners

The optimal expression strategy depends on your research objectives. Based on commercial production data, E. coli systems appear to be the most commonly used for recombinant G. bemidjiensis atpB . When expressing this membrane protein, consider using specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3), or Lemo21(DE3)). The addition of an N-terminal tag (commonly His10-tag) facilitates purification while minimizing interference with protein function .

What purification methods yield the highest purity and functional integrity of recombinant G. bemidjiensis atpB?

A multi-step purification approach is recommended for obtaining high-purity recombinant G. bemidjiensis atpB while maintaining its functional integrity:

  • Membrane Fraction Isolation:

    • Lyse cells using French press or sonication in buffer containing 50 mM Tris-HCl pH 8.0, 100 mM NaCl

    • Separate membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

    • Solubilize membranes with appropriate detergent (e.g., 1% DDM or 1% LMNG)

  • Affinity Chromatography:

    • For His-tagged protein, use Ni-NTA or TALON resin

    • Include 0.05-0.1% detergent in all buffers to maintain protein solubility

    • Elute with imidazole gradient (50-300 mM)

  • Size Exclusion Chromatography:

    • Further purify using Superdex 200 or similar

    • Buffer containing 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.03% DDM

  • Quality Assessment:

    • Verify purity by SDS-PAGE (>90% is typically achievable)

    • Assess functional integrity through ATP hydrolysis assays

For long-term storage, the protein should be maintained in Tris/PBS-based buffer with 6% trehalose at pH 8.0, and adding 50% glycerol is recommended for storage at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided to maintain protein integrity.

How can G. bemidjiensis atpB be used to study bacterial ATP release mechanisms in the context of sepsis research?

Recent research has revealed that bacterial ATP release plays a significant role in modulating immune responses during sepsis . G. bemidjiensis atpB can serve as a valuable tool for investigating these mechanisms through several research approaches:

  • Comparative Structural-Functional Analysis:

    • Generate recombinant atpB proteins with site-directed mutations at key residues

    • Assess how these mutations affect ATP release profiles compared to wild-type

    • Correlate structural alterations with functional consequences

  • In vitro Reconstitution Systems:

    • Incorporate purified atpB into liposomes to recreate minimal ATP synthesis systems

    • Measure ATP release under various conditions (pH gradients, membrane potential changes)

    • Use these systems to test potential inhibitors of bacterial ATP release

  • Immunological Studies:

    • Examine how ATP released via atpB-dependent mechanisms affects neutrophil function

    • Investigate potential therapeutic approaches targeting atpB to modulate immune responses during sepsis

Studies have demonstrated that ATP release is dependent on ATP synthase within the inner bacterial membrane and that bacterial ATP suppresses local immune responses, resulting in reduced neutrophil counts and impaired survival during sepsis . Researchers found that abrogating bacterial ATP release by introducing a periplasmic apyrase revealed that bacterial ATP has both local effects on immune response and systemic effects via transport in outer membrane vesicles .

What structural analysis techniques are most effective for studying the conformation and dynamics of G. bemidjiensis atpB?

Multiple complementary techniques can be employed to elucidate the structural characteristics and dynamic properties of G. bemidjiensis atpB:

TechniqueResolution/InformationAdvantagesLimitations
Cryo-EMNear-atomic resolution (2-4Å)Captures native conformation, requires less proteinChallenging for small membrane proteins alone
X-ray CrystallographyAtomic resolution (1-3Å)High detail of static structureDifficult crystallization of membrane proteins
NMR SpectroscopyAtomic details of dynamic regionsProvides information on protein dynamicsSize limitations, requires isotope labeling
Hydrogen-Deuterium Exchange MSRegional dynamics and accessibilityMaps solvent-accessible regionsLower resolution than atomic techniques
Molecular Dynamics SimulationsAtomistic motion over timePredicts conformational changesRequires validation with experimental data

For G. bemidjiensis atpB, cryo-EM has proven particularly valuable for studying intact ATP synthase complexes, as demonstrated with other bacterial ATP synthases . This approach can reveal how atpB interacts with other subunits and contributes to proton translocation. When designing structural studies, consider:

  • The membrane environment is crucial for maintaining native conformation

  • Detergent selection significantly impacts structural integrity

  • Combining multiple techniques provides the most comprehensive structural understanding

Structural studies on bacterial ATP synthases have revealed the path of transmembrane proton translocation and provided models for understanding the roles of specific residues in the enzyme .

What are the major challenges in expressing and purifying functional G. bemidjiensis atpB, and how can they be addressed?

Researchers face several significant challenges when working with recombinant G. bemidjiensis atpB:

  • Low Expression Yields:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solution: Optimize codon usage for expression host; use specialized strains (C41/C43); consider fusion partners (MBP, SUMO); test induction conditions systematically (temperature, inducer concentration, induction time)

  • Protein Aggregation:

    • Challenge: Hydrophobic regions promote aggregation during expression

    • Solution: Express at lower temperatures (16-18°C); include mild solubilizing agents (glycerol, specific detergents); consider refolding protocols from inclusion bodies

  • Maintaining Native Conformation:

    • Challenge: Detergent extraction can disrupt protein structure

    • Solution: Screen detergents systematically (DDM, LMNG, UDM); consider native nanodiscs or SMALPs for extraction; validate function with activity assays

  • Stability During Storage:

    • Challenge: Recombinant atpB may lose activity during storage

    • Solution: Store at -80°C with cryoprotectants (trehalose, glycerol); avoid freeze-thaw cycles; consider lyophilization for long-term storage

Methodically addressing these challenges requires iterative optimization. Document all conditions tested and implement quality control checkpoints throughout the workflow to ensure consistent protein preparation.

How can researchers differentiate between bacterial ATP release mechanisms in complex biological samples?

Distinguishing between different sources and mechanisms of ATP release in bacterial systems requires sophisticated experimental approaches:

  • Genetic Manipulation Strategy:

    • Generate defined mutants in specific ATP synthase components (e.g., ΔatpB, ΔatpF)

    • Compare ATP release profiles across mutant strains under identical conditions

    • Studies have shown that mutations in ATP synthase subunits result in significantly lower ATP release compared to mutations in cytochrome bo3 oxidase subunits

  • Temporal Analysis Approach:

    • Monitor ATP release kinetics over growth curve

    • Correlate release with growth phase and membrane integrity

    • Research has demonstrated that cumulative ATP release and cumulative growth are positively correlated

  • Biochemical Discrimination Method:

    • Use specific inhibitors targeting different potential release pathways

    • For ATP synthase: oligomycin, DCCD, venturicidin

    • For membrane integrity: polymyxin B, EDTA (as control)

    • For active transport: efflux pump inhibitors

  • Reporter Systems:

    • Transform bacteria with arabinose-inducible periplasmic apyrase to hydrolyze ATP

    • Compare ATP profiles between induced and non-induced conditions

    • This approach has been successfully used to demonstrate that bacterial ATP suppresses local immune responses during sepsis

Recent research using these approaches revealed that ATP release is directly dependent on ATP generation at the inner bacterial membrane, and impaired outer membrane integrity notably contributes to ATP release and is associated with bacterial death .

How might G. bemidjiensis atpB be utilized in developing novel antimicrobial strategies?

The essential role of ATP synthase in bacterial survival makes G. bemidjiensis atpB a promising target for innovative antimicrobial approaches:

  • Targeted Inhibition Strategies:

    • Develop small molecules specifically targeting unique structural features of G. bemidjiensis atpB

    • Design peptide inhibitors that disrupt critical protein-protein interactions within the ATP synthase complex

    • Create combination therapies targeting both ATP synthesis and membrane integrity

  • Immunomodulation Approaches:

    • Manipulate bacterial ATP release to enhance host immune response against infection

    • Research has shown that bacterial ATP shapes local and systemic inflammation

    • Targeted regulation of ATP synthase activity could potentially modulate immune responses during infection

  • Bioremediation Applications:

    • Engineer G. bemidjiensis with modified atpB to enhance its ability to remediate contaminated environments

    • G. bemidjiensis is known for its role in remediating subsurface environments contaminated with aromatic compounds

    • Optimizing energy production through ATP synthase could improve bioremediation efficiency

  • Diagnostic Tools:

    • Develop antibodies or aptamers against G. bemidjiensis atpB for rapid detection

    • Create biosensors based on ATP release profiles for monitoring bacterial contamination

Future research should explore structure-based drug design targeting specific regions of atpB and investigate the potential of ATP synthase inhibitors as novel antimicrobials against Geobacter species and related bacteria.

What role might atpB play in the adaptation of Geobacter bemidjiensis to different environmental conditions?

G. bemidjiensis is known for its versatile metabolism and ability to thrive in subsurface environments, particularly those contaminated with aromatic compounds . The atpB subunit likely plays critical roles in this environmental adaptability:

  • Energy Conservation Mechanisms:

    • ATP synthase efficiency may be modulated under different growth conditions

    • atpB structural modifications could optimize proton translocation efficiency based on environmental pH and redox state

    • Investigating how atpB expression and activity change under varying growth conditions would reveal adaptation mechanisms

  • Integration with Electron Transport Chains:

    • G. bemidjiensis can use various electron acceptors including Fe(III)

    • atpB likely interfaces with specialized electron transport components

    • Research question: How does atpB structure/function vary when cells use different electron acceptors?

  • Regulatory Networks:

    • atpB expression may be coordinated with other genes involved in energy metabolism

    • Similar to the regulation observed with benzoate metabolism genes in G. bemidjiensis

    • Transcription factors like BgeR may regulate energy metabolism genes in response to environmental conditions

  • Stress Response Mechanisms:

    • ATP synthesis regulation via atpB may be crucial during nutrient limitation

    • Potential connection between ATP synthase activity and formation of persister cells

    • Research direction: How does atpB contribute to survival under environmental stress?

Comparative studies between G. bemidjiensis atpB and homologs from other bacteria adapted to different niches would provide insights into how ATP synthase has evolved to support diverse metabolic lifestyles and environmental adaptations.

How should researchers interpret differences in ATP release profiles between wild-type and atpB mutant strains?

When analyzing ATP release data from wild-type G. bemidjiensis versus atpB mutants, consider these key interpretive frameworks:

  • Quantitative Analysis Framework:

ParameterWild-Type ProfileatpB Mutant ProfileInterpretation
Maximum ATP releaseHigherSignificantly loweratpB is essential for ATP synthesis and release
Release kineticsCorrelates with growthDisrupted correlationATP release depends on functional ATP synthase
Growth correlationStrong positive correlationWeak or no correlationATP synthesis directly impacts growth and release
Membrane integrityMaintainedVariableSecondary effects on membrane stability
  • Mechanistic Interpretation Guidelines:

    • Lower ATP release in atpB mutants confirms the protein's critical role in ATP synthesis

    • Altered release kinetics may reveal secondary transport mechanisms

    • Changes in growth correlation indicate the degree of metabolic dependency on ATP synthesis

  • Controlling for Confounding Variables:

    • Account for differences in growth rates when comparing ATP release

    • Consider cell lysis as a potential source of ATP (use viability assays)

    • Normalize data appropriately (per cell, per unit biomass)

Research has demonstrated that mutations in subunits of bacterial ATP synthase have a higher impact on ATP generation, growth, and ATP release than mutations in other components of energy metabolism . When analyzing experimental data, it's essential to consider both direct effects on ATP synthesis and indirect effects on bacterial physiology and membrane integrity.

What statistical approaches are most appropriate for analyzing structure-function relationships in atpB research?

  • Correlation Analysis for Structure-Activity Relationships:

    • Pearson or Spearman correlation to relate structural parameters to functional outcomes

    • Multiple regression to identify key structural determinants of function

    • Example: Correlating mutations in specific regions with ATP release profiles

  • Comparative Statistical Approaches:

    • ANOVA with post-hoc tests for comparing multiple variants

    • t-tests for pairwise comparisons between specific variants

    • Non-parametric alternatives when assumptions aren't met

  • Time Series Analysis for Dynamic Studies:

    • Area under the curve (AUC) calculations for cumulative effects over time

    • Studies have used AUC to assess cumulative ATP release and growth

    • Growth curve analysis using specialized software (GrowthRates, etc.)

  • Advanced Statistical Methods for Complex Datasets:

    • Principal component analysis (PCA) to identify patterns in multivariate data

    • Cluster analysis to group similar variants or conditions

    • Machine learning approaches for predicting structure-function relationships

  • Appropriate Controls and Replication:

    • Include positive and negative controls in all experiments

    • Perform biological replicates (n≥3) for robust statistical inference

    • Report effect sizes and confidence intervals, not just p-values

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.