Recombinant Geobacter bemidjiensis NADH-quinone oxidoreductase subunit K 1 (nuoK1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please let us know, and we will prioritize its development.
Synonyms
nuoK1; Gbem_0170; NADH-quinone oxidoreductase subunit K 1; NADH dehydrogenase I subunit K 1; NDH-1 subunit K 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622)
Target Names
nuoK1
Target Protein Sequence
MTIPLYEVLILASILFAMGLACVVAWRANVIMMLIGIEIMLNAVMLTFVGGSAHWGIAEG QVFSLMIMALTSAEVSLALAMVAYLHRRKQSVDTDDFSSMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this specific species, the enzyme's immediate electron acceptor is believed to be ubiquinone. It couples the redox reaction with proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of NADH-quinone oxidoreductase in Geobacter bemidjiensis?

NADH-quinone oxidoreductase in G. bemidjiensis functions as Complex I in the electron transport chain, catalyzing electron transfer from NADH to quinones while pumping protons across the membrane. This enzyme complex is particularly important in G. bemidjiensis due to its role in energy conservation during anaerobic respiration, especially in Fe(III)-reducing subsurface environments where this organism predominates . G. bemidjiensis exhibits enhanced respiratory capabilities and oxygen detoxification mechanisms compared to non-subsurface Geobacter species, suggesting specialized adaptations in its electron transport chain components .

Research methodology for studying this biological role typically includes:

  • Growth studies under various electron acceptor conditions

  • Membrane potential measurements

  • Comparative genomics with other Geobacter species

  • Gene knockout experiments to assess phenotypic changes

How does G. bemidjiensis nuoK1 differ from homologous proteins in other bacterial species?

The nuoK1 subunit in G. bemidjiensis likely contains unique structural and functional adaptations that contribute to the organism's ability to thrive in subsurface environments. Comparative analysis with other Geobacter species reveals that G. bemidjiensis has evolved specific metabolic capabilities including enhanced carbon dioxide fixation and the ability to grow by disproportionation of fumarate .

Methodological approach for comparative analysis:

  • Multiple sequence alignment of nuoK1 homologs across bacterial species

  • Phylogenetic analysis to determine evolutionary relationships

  • Structural prediction and comparison using homology modeling

  • Identification of conserved functional domains and species-specific variations

What expression systems are most effective for producing recombinant G. bemidjiensis nuoK1?

Expression of membrane proteins like nuoK1 presents significant challenges due to their hydrophobic nature and complex folding requirements. For G. bemidjiensis proteins, researchers often employ specialized expression systems that accommodate the unique characteristics of this anaerobic bacterium.

Based on established protocols for Geobacter species, the following expression approach is recommended:

  • Vector selection: Modified pET expression systems containing appropriate restriction sites (NdeI and EcoRI have been successfully used for other Geobacter proteins)

  • Host selection: E. coli strains optimized for membrane protein expression (C41(DE3) or C43(DE3))

  • Growth conditions: Microaerobic or anaerobic conditions may improve expression yields

  • Induction protocol: Lower temperatures (16-18°C) and reduced IPTG concentrations (0.1-0.5 mM) often yield better results for membrane proteins

For purification, a combination of detergent solubilization (typically n-dodecyl-β-D-maltoside) followed by affinity chromatography using a His-tag is typically effective.

How does the nuoK1 subunit contribute to the enhanced oxygen response mechanisms in G. bemidjiensis?

G. bemidjiensis demonstrates enhanced abilities to respire, detoxify, and avoid oxygen compared to non-subsurface Geobacter species . The nuoK1 subunit, as part of the NADH-quinone oxidoreductase complex, likely plays a critical role in this adaptation.

Research methodology for investigating this question:

  • Site-directed mutagenesis of conserved residues in nuoK1

  • Oxygen consumption measurements in wild-type and mutant strains

  • ROS generation assays under varying oxygen concentrations

  • Comparative analysis of nuoK1 expression levels under aerobic vs. anaerobic conditions

The unique metabolic capabilities of G. bemidjiensis, such as carbon dioxide fixation and growth on glucose , suggest that its electron transport chain components may have specialized functions that contribute to its ecological niche adaptation.

What role might nuoK1 play in the electron transfer mechanisms during Fe(III) reduction?

Geobacter species are known for their ability to transfer electrons to external acceptors such as Fe(III). The NADH-quinone oxidoreductase complex likely contributes to this process by generating the proton motive force necessary for ATP synthesis during Fe(III) reduction.

Experimental approaches to study this role include:

  • Development of a nuoK1 knockout strain to assess changes in Fe(III) reduction capacity

  • Electrochemical analysis using techniques such as cyclic voltammetry

  • Protein-protein interaction studies to identify potential connections between nuoK1 and outer membrane electron transfer components

  • Single-molecule localization microscopy to visualize potential co-localization with other electron transfer proteins

How does nuoK1 contribute to the fumarate disproportionation capability of G. bemidjiensis?

G. bemidjiensis possesses a unique ability to grow by disproportionation of fumarate, which may be explained by the presence of different dicarboxylic acid transporters and two oxaloacetate decarboxylases . The NADH-quinone oxidoreductase complex could play an indirect role in this process by maintaining the redox balance during fumarate metabolism.

Metabolic CapabilityG. bemidjiensisNon-subsurface Geobacter species
Fumarate disproportionationYesNo
CO₂ fixationYesLimited
Growth on glucoseYesNo
Vitamin requirementYes (4-aminobenzoate)No

To investigate the role of nuoK1 in fumarate metabolism:

  • Monitor expression levels of nuoK1 during growth on fumarate vs. other carbon sources

  • Conduct metabolic flux analysis with labeled fumarate

  • Perform protein-protein interaction studies to identify potential interactions between nuoK1 and fumarate metabolizing enzymes

What experimental approaches can be used to study the membrane topology and protein-protein interactions of nuoK1?

Understanding the membrane topology and interaction partners of nuoK1 is crucial for elucidating its function. The following methods are particularly valuable:

  • Cysteine scanning mutagenesis combined with accessibility labeling

  • FRET-based interaction assays using fluorescently labeled proteins

  • Crosslinking experiments followed by mass spectrometry analysis

  • Single-molecule localization microscopy with home-built anaerobic imaging chambers

The latter approach has been successfully used for imaging live Geobacter sulfurreducens, maintaining anaerobic conditions through constant argon bubbling . This technique could be adapted to study nuoK1 localization and dynamics in G. bemidjiensis.

What are the challenges in crystallizing membrane proteins like nuoK1, and what strategies can overcome these issues?

Membrane proteins present significant challenges for structural studies due to their hydrophobic nature, conformational flexibility, and requirement for detergents or lipid environments. For nuoK1 specifically:

Challenges:

  • Small size and multiple transmembrane domains make it difficult to crystallize in isolation

  • Hydrophobic surfaces limit crystal contact formation

  • Maintaining native conformation in detergent environments

Strategies:

  • Co-crystallization with antibody fragments or nanobodies to increase hydrophilic surface area

  • Lipidic cubic phase crystallization

  • Cryo-electron microscopy of the entire NADH-quinone oxidoreductase complex

  • Fusion with crystallization chaperones like T4 lysozyme or thermostabilized apocytochrome b562

How can researchers optimize anaerobic conditions for studying nuoK1 function in vitro?

Given that G. bemidjiensis is an anaerobic organism with enhanced abilities to respond to oxygen , maintaining strict anaerobic conditions is critical for functional studies of nuoK1.

Recommended methodology:

  • Use of specialized anaerobic chambers with constant argon bubbling, similar to the setup used for single-molecule imaging of Geobacter

  • Incorporation of oxygen scavenging systems in reaction buffers:

    • Enzymatic: Glucose oxidase/catalase

    • Chemical: Sodium dithionite or titanium(III) citrate

  • Inclusion of redox indicators (e.g., resazurin) to monitor oxygen contamination

  • Pre-reduction of media components and buffers

Specialized equipment needed:

  • Anaerobic glove box for protein preparation

  • Sealed cuvettes with gas-tight septa for spectrophotometric assays

  • Custom-designed anaerobic imaging chambers for microscopy studies

What approaches can be used to study the electron transfer kinetics of recombinant nuoK1?

Electron transfer is a fundamental aspect of NADH-quinone oxidoreductase function. To study the kinetics of this process in recombinant nuoK1:

  • Stopped-flow spectroscopy to measure rapid kinetics of NADH oxidation

  • Protein film voltammetry to analyze direct electron transfer properties

  • EPR spectroscopy to identify and characterize paramagnetic intermediates

  • Reconstitution of nuoK1 into liposomes containing fluorescent probes to measure proton translocation

Data analysis approaches:

  • Pre-steady-state kinetics modeling

  • Marcus theory applications for electron transfer rate calculations

  • Global fitting of spectroscopic data to reaction models

How can genetic manipulation techniques be applied to study nuoK1 function in G. bemidjiensis?

Genetic manipulation of G. bemidjiensis allows for in vivo functional studies of nuoK1. Based on established protocols for Geobacter species:

  • Gene replacement strategy:

    • Amplify upstream and downstream regions of nuoK1 by PCR using primers containing appropriate restriction sites (e.g., EcoRI and HindIII)

    • Clone these fragments with a kanamycin resistance gene into a suitable vector

    • Introduce the construct into G. bemidjiensis by electroporation

    • Select transformants using kanamycin resistance

    • Confirm gene replacement by PCR verification

  • Complementation studies:

    • Clone the wild-type nuoK1 gene into an expression vector like pCDNdeII

    • Introduce the construct into the nuoK1 knockout strain

    • Induce expression with IPTG and assess restoration of function

  • Reporter gene fusions:

    • Create translational fusions with reporter proteins such as GFP or luciferase

    • Use these constructs to study nuoK1 expression patterns and localization

What bioinformatic tools are most useful for analyzing nuoK1 sequence and structural features?

Computational analysis can provide valuable insights into nuoK1 function and evolution:

  • Sequence analysis tools:

    • BLAST for identifying homologs across species

    • Clustal Omega for multiple sequence alignment

    • HMMER for identifying conserved domains

    • MEGA for phylogenetic analysis

  • Structural prediction tools:

    • TMHMM or TOPCONS for transmembrane domain prediction

    • AlphaFold2 for 3D structure prediction

    • ConSurf for identifying evolutionarily conserved residues

    • PyMOL for structural visualization and analysis

  • Systems biology approaches:

    • Integration of nuoK1 function into genome-scale metabolic models

    • Prediction of protein-protein interactions using tools like STRING

    • Metabolic flux analysis to understand the role of nuoK1 in G. bemidjiensis metabolism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.