Recombinant Geobacter bemidjiensis NADH-quinone oxidoreductase subunit K 2 (nuoK2)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

Recombinant nuoK2 is produced using heterologous expression systems:

ParameterMammalian Cell System Yeast System
Product CodeCSB-MP473118GFN1CSB-YP473118GFN1
Purity>85% (SDS-PAGE)>85% (SDS-PAGE)
Storage-20°C/-80°C (lyophilized: 12 mo)-20°C/-80°C (lyophilized: 12 mo)
Reconstitution0.1–1.0 mg/mL in sterile water0.1–1.0 mg/mL in sterile water
TagDetermined during productionDetermined during production

Note: Both systems yield functional protein, though post-translational modifications may differ .

Functional Role

nuoK2 contributes to NADH dehydrogenase activity within respiratory chains:

  • Electron Transfer: Transfers electrons from NADH to quinone, generating a proton gradient for ATP synthesis .

  • Methanotroph Support: Homologs in Methylococcus capsulatus enable methane oxidation by supplying reducing equivalents to methane monooxygenase (pMMO) .

  • Inhibitor Sensitivity: Resistant to rotenone but partially inhibited by amytal, distinguishing it from mitochondrial Complex I .

Enzyme Kinetics

  • Substrate Specificity: Reduces coenzyme Q₀, duroquinone, and menaquinone efficiently .

  • Activity Assays: Measured via NADH oxidation rates or quinone reduction in solubilized membranes .

Biotechnological Tools

  • ELISA Kits: Available for quantification (e.g., Product Code CSB-CF473118GFN) .

  • Interaction Studies: Used to map protein-protein interactions in electron transport complexes .

Comparative Analysis

nuoK2 shares functional homology with subunits from other Geobacter species:

SpeciesSubunitGeneEC Number
G. sulfurreducensnuoK2GSU34321.6.99.5
G. metallireducensnuoK2Gmet_39161.6.99.5
G. uraniireducensnuoK2Gur_34501.6.99.5

Critical Research Findings

  • Electron Transport Decoupling: Detergent solubilization disrupts NADH-dependent activity, restored by exogenous quinones like decyl-plastoquinone .

  • Flavin Dependency: UV-visible spectroscopy confirms FAD as an essential cofactor .

  • Stability: Repeated freeze-thaw cycles degrade activity; working aliquots stored at 4°C retain function for ≤1 week .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will then prepare your order according to your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK2; Gbem_3916; NADH-quinone oxidoreductase subunit K 2; NADH dehydrogenase I subunit K 2; NDH-1 subunit K 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622)
Target Names
nuoK2
Target Protein Sequence
MLAIENYLILSAILFSIGTIGVLTRRNAIVIFMCIEMMLNAVNLTFIAFSRHLGNIDGQV FVFFVMTVAAAEAAVGLALMIAFFKNRESIDVEDVNLMKL
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction to proton translocation, where for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane, thereby conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is NADH-quinone oxidoreductase (Complex I) and what role does it play in Geobacter species?

NADH-quinone oxidoreductase (Complex I) is a multisubunit integral membrane enzyme found in bacterial respiratory chains, including those of Geobacter species. This enzyme couples the oxidation of NADH to the reduction of quinones while simultaneously pumping protons across the membrane to generate a proton motive force (PMF). In bacteria, Complex I plays diverse roles depending on the organism's metabolic capabilities.

Unlike Escherichia coli, where Complex I is not required for aerobic respiration but is essential for anaerobic fumarate respiration, in other bacteria such as Rhodobacter capsulatus, Complex I is required for phototrophic growth where it catalyzes the reverse reaction, using PMF to drive NADH synthesis from quinol . This enzyme is widespread in bacteria, predicted to be present in approximately 50% of bacterial genomes analyzed, and is associated with specific lifestyles including aerobic respiration and certain types of phototrophy .

In Geobacter species, which are known for their capacity to reduce metals and remediate contaminated environments, Complex I likely plays a critical role in their unique form of anaerobic respiration and energy conservation.

  • How are the genes encoding Complex I organized in bacterial genomes?

The genes encoding the subunits of Complex I (nuoA through nuoN) show a high degree of genomic organization across bacterial species. According to phylogenomic analysis of 970 representative bacterial genomes, these genes were colocalized in 86% of the bacterial genomes where the enzyme was found, indicating they likely form a polycistronic operon . This organization is similar to that found in Escherichia coli.

In typical bacterial systems, the nuo operon encodes the 14 core subunits that make up the complete Complex I. The nuoK gene encodes one of the membrane-embedded subunits that forms part of the proton translocation machinery. The presence of a "nuoK2" designation suggests the existence of multiple variants or copies of this gene in G. bemidjiensis, which could represent specialized adaptations to its unique metabolic capabilities.

  • What genetic manipulation techniques are available for Geobacter species?

Several genetic tools and techniques have been developed specifically for Geobacter species that could be applied to studies of recombinant nuoK2:

TechniqueApplicationDetails
ElectroporationIntroduction of foreign DNAProtocol optimized for Geobacter species
Broad-host-range vectorsDNA replicationIncQ and pBBR1 vectors demonstrated to replicate in Geobacter
Expression vectorsGene complementationIncQ plasmid pCD342 suitable for expression in Geobacter
Single-step gene replacementGene disruptionSuccessfully used for targeted disruption of genes like nifD
Primer extension assaysGene expression analysisUsed to examine transcription of genes in G. bemidjiensis

The development of a genetic system for Geobacter sulfurreducens has established protocols for antibiotic sensitivity characterization, optimal plating conditions, and methods for the introduction of foreign DNA . These techniques provide a foundation that can be adapted for recombinant expression and characterization of nuoK2 in G. bemidjiensis.

  • What is known about the metabolic versatility of Geobacter bemidjiensis?

Geobacter bemidjiensis demonstrates remarkable metabolic versatility that distinguishes it from other bacterial species:

G. bemidjiensis can mediate multiple mercury transformations under anoxic conditions, including Hg(II) reduction, Hg(0) oxidation, methylmercury (MeHg) production, and MeHg degradation . The bacterium appears to utilize a reductive demethylation pathway to degrade MeHg, with elemental Hg(0) as the major reaction product, possibly due to the presence of genes encoding homologues of an organomercurial lyase (MerB) and a mercuric reductase (MerA) .

Additionally, G. bemidjiensis can metabolize aromatic compounds such as benzoate, which is relevant for bioremediation of contaminated subsurface environments . A cluster of genes involved in benzoate metabolism has been identified in the G. bemidjiensis genome, with many of these genes being upregulated during growth with benzoate compared to growth with acetate .

This metabolic versatility likely requires specialized adaptations in the respiratory chain components, potentially including variants of Complex I subunits like nuoK2.

  • How is gene expression regulated in Geobacter bemidjiensis?

Gene expression in G. bemidjiensis involves complex regulatory mechanisms:

Studies of the benzoate metabolism gene cluster in G. bemidjiensis have revealed multiple regulatory elements. Promoter analysis identified both RpoD-dependent (−35 and −10) promoter elements and RpoN-dependent (−24 and −12) promoter elements . This suggests that multiple RNA polymerase sigma factors are involved in gene expression regulation in G. bemidjiensis.

The consensus sequences for Geobacter RpoN promoters are TGGCACG (−24) and TTGCA/T (−12), with the dinucleotides GG and GC being highly conserved in the −24 and −12 promoter elements, respectively .

Transcriptional repressors have also been identified in G. bemidjiensis. For example, a transcription factor that represses expression of bamA (a benzoate-inducible gene) during growth with acetate has been characterized . Multiple putative transcription factors are located in or near the benzoate gene cluster, including members of the IclR family, the Rrf2 family, and enhancer-binding proteins .

Understanding these regulatory mechanisms is crucial for studying the expression and function of genes like nuoK2.

Advanced Research Questions

  • What experimental approaches would be most effective for characterizing the function of nuoK2 in G. bemidjiensis?

Based on established techniques for Geobacter species, a comprehensive experimental strategy for characterizing nuoK2 function would include:

  • Gene Disruption and Complementation: Create a nuoK2 knockout mutant using the single-step gene replacement method demonstrated for nifD in G. sulfurreducens . This would involve constructing a disruption vector containing a selectable marker (e.g., kanamycin resistance) flanked by sequences homologous to the nuoK2 gene. Complementation studies using an IncQ expression vector like pCD342 would confirm phenotype specificity.

  • Comparative Growth Studies: Assess growth characteristics of wild-type, nuoK2-disrupted, and complemented strains under various electron donor/acceptor combinations to identify conditions where nuoK2 is essential or provides advantages.

  • Gene Expression Analysis: Use primer extension assays similar to those employed for analyzing benzoate metabolism genes to determine the expression pattern of nuoK2 under different growth conditions.

  • Protein Localization: Develop tagged versions of nuoK2 to confirm its localization within the membrane and association with other Complex I subunits.

  • Biochemical Characterization: Express and purify recombinant nuoK2 protein for structural and functional studies, potentially using the established electroporation and expression vector systems .

  • How might the structure and function of nuoK2 differ from the canonical nuoK in respiratory Complex I?

While the search results don't provide specific structural information about nuoK2, we can make informed predictions based on general principles of protein evolution and the diverse roles of Complex I across bacterial species :

The nuoK subunit typically functions as part of the membrane domain of Complex I, contributing to the proton translocation pathway. The existence of a second variant (nuoK2) suggests potential structural or functional specialization that could manifest in several ways:

  • Modified Proton Pumping Efficiency: Alterations in key residues within transmembrane helices could affect the efficiency or stoichiometry of proton translocation.

  • Altered Quinone Specificity: G. bemidjiensis may utilize different quinone species under varying environmental conditions, and nuoK2 might provide adaptation to specific quinone types.

  • Enhanced Stability Under Specific Conditions: nuoK2 might offer structural stability to Complex I under particular stress conditions relevant to G. bemidjiensis' ecological niche.

  • Alternative Subunit Interactions: nuoK2 could facilitate interactions with other proteins or respiratory complexes specific to G. bemidjiensis metabolism.

Determining these differences would require comparative sequence analysis, homology modeling, and functional reconstitution studies.

  • What is the evolutionary significance of having a second copy of the nuoK gene in G. bemidjiensis?

The presence of nuoK2 in G. bemidjiensis represents an interesting evolutionary development with several potential explanations:

Complex I evolution generally follows bacterial phylogeny, with some notable exceptions . The gammaproteobacteria, for example, encode one of two distantly related Complex I enzymes predicted to participate in different types of respiratory chains (aerobic versus anaerobic) .

The nuoK2 gene likely arose through gene duplication, a major mechanism for the evolution of new protein functions. Its retention in the genome suggests it provides selective advantages that could include:

  • Metabolic Versatility: G. bemidjiensis demonstrates remarkable metabolic capabilities, including mercury transformation and aromatic compound degradation . nuoK2 might support specialized respiratory chains optimized for these unique metabolic pathways.

  • Environmental Adaptation: A second nuoK variant could allow adaptation to fluctuating environmental conditions in the subsurface habitats where Geobacter species thrive.

  • Functional Redundancy: Critical components of essential electron transport chains are sometimes duplicated to ensure system robustness.

  • Neofunctionalization: Following duplication, nuoK2 might have evolved entirely new functions beyond the canonical role of nuoK in Complex I.

  • What challenges might researchers face when expressing recombinant G. bemidjiensis nuoK2 for structural and functional studies?

Recombinant expression of membrane proteins like nuoK2 presents several significant challenges:

ChallengeDescriptionPotential Solutions
Anaerobic expression requirementsG. bemidjiensis is strictly anaerobic , potentially affecting proper folding of nuoK2Develop anaerobic expression systems or express in anaerobic hosts
Membrane protein solubilityHydrophobic membrane proteins are difficult to express and purifyUse specialized detergents or membrane mimetics like nanodiscs
Complex I assemblynuoK2 normally functions within a 14-subunit complex Consider co-expression with interacting subunits or minimal functional units
Post-translational modificationsAny required modifications may be absent in heterologous hostsChoose expression hosts phylogenetically closer to Geobacter
Conformational dynamicsCapturing various functional states for structural studiesUtilize stabilizing mutations or conformation-specific antibodies

The genetic system developed for G. sulfurreducens provides a potential foundation for homologous expression strategies that might overcome some of these challenges.

  • How might nuoK2 contribute to the bioremediation capabilities of G. bemidjiensis?

G. bemidjiensis has demonstrated significant potential for bioremediation of contaminated environments:

The bacterium can remediate subsurface environments contaminated with aromatic compounds and has been shown to mediate multiple mercury transformations under anoxic conditions, including mercury methylation and demethylation .

nuoK2, as part of a potentially specialized Complex I variant, might contribute to these bioremediation capabilities in several ways:

  • Energy Conservation During Contaminant Metabolism: A specialized Complex I containing nuoK2 could optimize energy recovery during the oxidation of contaminants like aromatic compounds, supporting growth under challenging conditions.

  • Redox Balancing: During mercury transformations, maintaining proper cellular redox balance is crucial. nuoK2 might facilitate electron transfer processes specifically adapted to these reactions.

  • Stress Response: Contaminant metabolism often generates oxidative or other stresses. nuoK2 could be part of a modified respiratory chain that functions more effectively under these stress conditions.

  • Adaptation to Low-Energy Substrates: Contaminated environments often provide limited energy substrates. nuoK2 might improve energy conservation efficiency when G. bemidjiensis is metabolizing these challenging compounds.

Experimental studies comparing wild-type and nuoK2-deficient strains during contaminant metabolism would be valuable for testing these hypotheses and potentially improving bioremediation applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.